Search
Invitrogen
GSTM1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 9
GSTM1 Antibody (PA5-79337) in ICC/IF
Immunofluorescence analysis of Glutathione S-transferase Mu 1 was performed using 70% confluent log phase HeLa cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 45 minutes at room temperature. The cells were labeled with GSTM1 Polyclonal Antibody (Product # PA5-79337) at 1:100 in 0.1% BSA, incubated at 4 degree celsius overnight and then labeled with Goat anti-Rabbit IgG (H+L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor Plus 488 (... View More
Product Details
PA5-79337
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Mouse,
Rat,
Human
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, rat lung tissue, mouse stomach tissue, mouse kidney tissue. ICC/IF: U20S cells. Flow: HeLa cell.
Target Information
Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13. 3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; Glutathione S-transferase GT8.7; glutathione S-transferase M1; Glutathione S-transferase Mu 1; Glutathione S-transferase Yb-1; glutathione S-transferase Yb-1 subunit; glutathione-S-transferase mu type 1 (Yb1); glutathione-S-transferase, mu 1; glutathione-S-transferase, mu type 1 (Yb1); GST 1-1; GST 3-3; GST class-mu 1; GST HB subunit 4; GST Yb1; GSTM1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; HB subunit 4; pmGT10; S-(hydroxyalkyl)glutathione lyase; unnamed protein product
Gene Aliases: GST1; GSTA3; Gstb-1; Gstb1; GSTM1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; GTM1; H-B; MU; MU-1
UniProt ID: (Human) P09488, (Mouse) Q58ET5, (Rat) P04905
Entrez Gene ID: (Human) 2944, (Mouse) 14862, (Rat) 24423
lipid metabolic process
prostaglandin metabolic process
glutathione metabolic process
nitrobenzene metabolic process
xenobiotic catabolic process
hepoxilin biosynthetic process
cellular detoxification of nitrogen compound
glutathione derivative biosynthetic process
metabolic process
cellular response to drug
sensory perception of smell
response to metal ion
response to lithium ion
response to lead ion
response to drug
response to amino acid
response to ethanol
response to antibiotic
response to axon injury
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support