Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Pedidos
            • Productos y proyectos personalizados
          • Primary Antibodies ›
          • MMP8 Antibodies

          Invitrogen

          MMP8 Polyclonal Antibody

          1 Published Figure
          3 References
          View all (19) MMP8 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite MMP8 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          • Published Figures (1)
          MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          MMP8 Antibody (PA5-79687) in IHC (P)

          Immunohistochemistry analysis of MMP-8 on paraffin-embedded mouse spleen tissue. Sample was incubated with MMP-8 polyclonal antibody (Product# PA5-79687). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MMP8 Antibody in Western Blot (WB)
          MMP8 Antibody in Western Blot, Immunocytochemistry (WB, ICC/IF)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          MMP8 Polyclonal Antibody

          Product Details

          PA5-79687

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          -
          View 1 publication 1 publication

          ELISA (ELISA)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746802

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Mouse Testis Tissue, NIH3T3 whole cell, HEPA whole cell, NRK whole cell. IHC: Mouse Spleen tissue, Rat Spleen tissue.

          Target Information

          The MMP8 gene encodes matrix metalloproteinase-8, also known as collagenase-2, an enzyme belonging to the matrix metalloproteinase (MMP) family, which plays a pivotal role in the breakdown of extracellular matrix (ECM) components. MMP8 is primarily involved in the degradation of type I and III collagen, facilitating tissue remodeling and repair processes. This enzyme is produced by neutrophils and is active in areas of tissue inflammation and injury, where it modulates the ECM to aid in wound healing. MMP8 is implicated in various physiological processes, including embryonic development, angiogenesis, and bone remodeling. However, excessive or unregulated activity of MMP8 can lead to pathological conditions such as arthritis, periodontal disease, and cancer metastasis, where ECM degradation contributes to disease progression. Research into MMP8 aims to understand its regulation and involvement in disease states, providing insights into potential therapeutic strategies for targeting MMP activity in inflammatory and degenerative conditions.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: Collagenase; collagenase-2; matrix metallo protease; matrix metalloproteinase-8; Matrix metalloproteinase8; MMP; MMP 8; MMP-8; MMPs; MNC; neutrophil collagenease; PMNL CL; PMNLCL; unnamed protein product

          View more View less

          UniProt ID: (Rat) O88766, (Mouse) O70138

          View more View less

          Entrez Gene ID: (Rat) 63849, (Mouse) 17394

          View more View less

          Function(s)
          endopeptidase activity metalloendopeptidase activity serine-type endopeptidase activity calcium ion binding peptidase activity metallopeptidase activity zinc ion binding tumor necrosis factor binding
          Process(es)
          ossification proteolysis protein catabolic process extracellular matrix organization collagen catabolic process positive regulation of tumor necrosis factor production endodermal cell differentiation cellular response to lipopolysaccharide positive regulation of neuroinflammatory response positive regulation of tumor necrosis factor-mediated signaling pathway positive regulation of microglial cell activation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-green-5799cd5976-5rqsh:80/100.66.74.151:80.
          git-commit: e30ab741173a2eb62411af663260592d4bdb9634
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.55.0-2026.07.30-1.0