Search

  • Contáctenos
  • Orden Rápida

Invitrogen

PML Polyclonal Antibody

View all (24) PML antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
{{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation'] || 'Additional Information'}}: {{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:

{{$ctrl.translations[$ctrl.isSkuNotesCollapsed ? 'antibody.pdp.skuNotes.viewMore' : 'antibody.pdp.skuNotes.viewLess']}}
PML Polyclonal Antibody

Product Details

PA5-79835

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

5 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human PML Protein (141-179aa FECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLD).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL once reconstituted

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746950

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell, human HEK293 whole cell, human U87 whole cell, human A431 whole cell, human K562 whole cell. IHC: human intestinal cancer tissue, human mammary cancer tissue. Flow: A431 cell.

Target Information

The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: E3 SUMO-protein ligase PML; My1 (PML); PML; PML/RARA fusion; pml1; probable transcription factor PML; promyelocytic leukemia protein; promyelocytic leukemia, inducer of; putative; RING finger protein 71; RING-type E3 SUMO transferase PML; tripartite motif protein TRIM19; tripartite motif-containing protein 19; unnamed protein product

View more View less

Gene Aliases: MYL; PP8675; RNF71; TRIM19

View more View less

UniProt ID: (Human) P29590

View more View less

Entrez Gene ID: (Human) 5371

View more View less

Function(s)
transcription coactivator activity protein binding zinc ion binding SUMO transferase activity ubiquitin protein ligase binding SUMO binding identical protein binding protein homodimerization activity SMAD binding metal ion binding protein heterodimerization activity cobalt ion binding binding, bridging ubiquitin-like protein ligase activity
Process(es)
response to hypoxia positive regulation of defense response to virus by host chromatin remodeling regulation of transcription, DNA-templated protein targeting apoptotic process negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to DNA damage regulation of calcium ion transport into cytosol negative regulation of gene expression fibroblast migration negative regulation of angiogenesis protein sumoylation regulation of cell adhesion negative regulation of cell growth DNA damage response, signal transduction by p53 class mediator PML body organization positive regulation of telomere maintenance negative regulation of telomere maintenance via telomerase endoplasmic reticulum calcium ion homeostasis negative regulation of interleukin-1 beta production negative regulation of interleukin-1 production circadian regulation of gene expression negative regulation of translation in response to oxidative stress response to cytokine protein localization to nucleus regulation of circadian rhythm intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator entrainment of circadian clock by photoperiod proteasome-mediated ubiquitin-dependent protein catabolic process negative regulation by host of viral release from host cell innate immune response establishment of protein localization negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated negative regulation of mitotic cell cycle positive regulation of fibroblast proliferation protein stabilization regulation of protein metabolic process maintenance of protein location in nucleus regulation of cell cycle positive regulation of apoptotic process involved in mammary gland involution protein-containing complex assembly cellular senescence oncogene-induced cell senescence antiviral innate immune response positive regulation of signal transduction by p53 class mediator positive regulation of protein localization to chromosome, telomeric region negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process regulation of double-strand break repair positive regulation of apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support