Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • New Products
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • DARPP-32 Antibodies

          Invitrogen

          DARPP-32 Polyclonal Antibody

          Advanced Verification
          View all (30) DARPP-32 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite DARPP-32 Polyclonal Antibody

          Additional Information:

          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (9)
          • Advanced Verification (1)
          DARPP-32 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          DARPP-32 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 10

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          DARPP-32 Antibody (PA5-79859) in IHC (P)

          Immunohistochemistry analysis of DARPP-32 on paraffin-embedded human lung cancer tissue. Sample was incubated with DARPP-32 polyclonal antibody (Product# PA5-79859) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          DARPP-32 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          DARPP-32 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          DARPP-32 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          DARPP-32 Antibody in Western Blot (WB)
          DARPP-32 Antibody in Western Blot (WB)
          DARPP-32 Antibody in Flow Cytometry (Flow)
          DARPP-32 Antibody in Flow Cytometry (Flow)
          DARPP-32 Antibody in Flow Cytometry (Flow)
          DARPP-32 Antibody in Flow Cytometry (Flow)
          DARPP-32 Antibody

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          DARPP-32 Polyclonal Antibody

          Product Details

          PA5-79859

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746974

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human CACO-2 whole cell, rat brain tissue, mouse brain tissue. IHC: mouse pancreas tissue, rat intestine tissue, human lung cancer tissue. Flow: THP-1 cell, PC-3 cell.

          Target Information

          DARPP-32 is a dopamine (DA) and AMP-regugated ~32 kDa phosphoprotein that is associated with dopaminoceptive neurons. The protein inhibits Protein Phosphatase I when it is phosphorylated on Thr34. In contrast, when DARPP-32 is phosphorylated on Thr75 the protein acts as an inhibitor of PKA. Phosphorylation of DARPP-32 is thought to play a critical role in the regugation of dopaminergic neurotransmission. In addition, the activity of DARPP-32 is also thought to play important roles in the actions of alcohol, caffeine and Prozac®.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: dopamine and cAMP regulated phosphoprotein; dopamine and cAMP-regulated neuronal phosphoprotein 32; dopamine- and cAMP-regulated neuronal phosphoprotein; dopamine- and cAMP-regulated phosphoprotein DARPP-32; FLJ20940; IPPD; neuronal phosphoprotein DARPP-32; OTTHUMP00000164275; OTTHUMP00000164276; PKA-potentiated phosphatase 1 inhibitory protein PP1; PPR1B; protein pho; unnamed protein product

          View more View less

          Gene Aliases: DARPP-32; DARPP32

          View more View less

          UniProt ID: (Human) Q9UD71, (Mouse) Q60829, (Rat) Q6J4I0

          View more View less

          Entrez Gene ID: (Human) 84152, (Mouse) 19049, (Rat) 360616

          View more View less

          Function(s)
          protein kinase inhibitor activity cAMP-dependent protein kinase inhibitor activity protein phosphatase inhibitor activity protein binding protein phosphatase regulator activity protein serine/threonine phosphatase inhibitor activity D1 dopamine receptor binding D2 dopamine receptor binding D3 dopamine receptor binding D4 dopamine receptor binding D5 dopamine receptor binding
          Process(es)
          response to amphetamine transcription, DNA-templated signal transduction memory negative regulation of female receptivity locomotory behavior visual learning response to nicotine intracellular signal transduction response to cocaine response to morphine behavioral response to cocaine cellular response to cocaine
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-blue-5bc99cc877-v966v:80/100.66.72.244:80.
          git-commit: a70b05477dc28cec55d7eafa2ce360191b99e591
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.58.0-2026.09.99-1.0