Search
Invitrogen
PSMA3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 5
PSMA3 Antibody (PA5-79890) in IHC (P)
Immunohistochemistry analysis of PSMA3 on paraffin-embedded human intestinal cancer tissue. Sample was incubated with PSMA3 polyclonal antibody (Product# PA5-79890) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method.
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79890
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat testis tissue, mouse lung tissue, 293T whole cell. IHC: mouse brain tissue, rat brain tissue, human intestinal cancer tissue. Flow: HeLa cell.
Target Information
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: alpha-7; macropain subunit C8; multicatalytic endopeptidase complex subunit C8; multicatalytic proteinase subunit K; proteasome (prosome, macropain) subunit, alpha type 3; proteasome (prosome, macropain) subunit, alpha type, 3; proteasome component C8; proteasome subunit alpha 3; proteasome subunit alpha-7; proteasome subunit alpha7; proteasome subunit C8; proteasome subunit K; PSA3; PSMA3; similar to Rattus norvegicus and Homo sapiens alpha7/C8 subunit; testicular secretory protein Li 43; unnamed protein product
Gene Aliases: HC8; Lmpc8; PSC3; Psma3l
UniProt ID: (Human) P25788, (Rat) P18422, (Mouse) O70435
Entrez Gene ID: (Human) 5684, (Rat) 29670, (Mouse) 19167
ubiquitin-dependent protein catabolic process
response to oxidative stress
proteasomal protein catabolic process
protein catabolic process
proteasome-mediated ubiquitin-dependent protein catabolic process
regulation of proteasomal protein catabolic process
immune system process
DNA repair
apoptotic process
cellular response to DNA damage stimulus
spermatogenesis
proteasomal ubiquitin-independent protein catabolic process
sperm motility
positive regulation of interferon-gamma production
positive regulation of interleukin-2 production
positive regulation of tumor necrosis factor production
response to interferon-gamma
CD8-positive, alpha-beta T cell differentiation
thymic T cell selection
T-helper 1 cell differentiation
negative regulation of regulatory T cell differentiation
meiotic cell cycle
cellular response to type I interferon
T-helper 17 cell differentiation
CD8-positive, alpha-beta T cell homeostasis
regulation of G1/S transition of mitotic cell cycle
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support