Search
Invitrogen
Tnfaip6 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
Tnfaip6 Antibody (PA5-95423) in WB
Western blot analysis of Tnfaip6 in rat brain extract (lane 1) and HeLa whole cell lysates (lane 2). Samples were incubated with Tnfaip6 polyclonal antibody (Product # PA5-95423) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL).
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-95423
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, human Hela whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The TSG6 gene is transcribed in normal fibroblasts and activated by binding of the cytokines TNF alpha and IL-1 at AP-1 and NF-IL6 sites in its promoter. TSG-6 is a glycoprotein and a member of the hyaluronan-binding protein family, which includes cartilage link protein, proteoglycan core protein and the adhesion receptor CD44. TSG-6 is highly homologous to CD44, particularly in the hyaluronic acid-binding domain. TSG-6 is found in TNF-treated cells; its expression is rapidly activated by TNF alpha, IL-1 and lipopolysaccharide in normal fibroblasts, peripheral blood mononuclear cells, synovial cells and chondrocytes. The presence of TSG-6 in synovial fluid suggests a possible role in rheumatoid arthritis. TSG-6 forms a stable complex with components of the serine protease inhibitor, inter-alpha-inhibitor (I alpha I)). TSG-6 potentiates the inhibitory effect of l alpha l on the protease activity of plasmin. Through their cooperative inhibitory effect on plasmin, TSG-6 and l alpha l can modulate the protease network and thus inhibit inflammation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: tumor necrosis factor-inducible gene 6 protein
Gene Aliases: Tnfip6
Entrez Gene ID: (Rat) 84397
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support