Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PPY (aa 33-95) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102616
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83223. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The PPY gene encodes pancreatic polypeptide, a peptide hormone involved in the regulation of appetite and energy balance. The origin of the PPY gene is linked to a tandem duplication of the PYY gene, occurring concomitantly with the emergence of tetrapods, leading to the distinct PPY function within the neuropeptide Y family. In primates and ungulates, a gene duplication event resulted in the formation of a PYY2-PPY2 gene cluster, highlighting the evolutionary complexity of these genes. The PPY gene product is secreted by gamma-cells in the pancreas, localized primarily in the islet periphery, and plays a crucial role in metabolic homeostasis by interacting with receptors in the central nervous system to modulate satiety signals postprandially. PPY's function is linked to its inhibition of AGRP/NPY neurons which decreases their suppressive effect on POMC neurons, enhancing POMC activity and contributing to appetite suppression. This intricate regulation underscores the importance of PPY in dietary intake and metabolic disorders, with ongoing research exploring its potential therapeutic applications.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: HGNC:9327; IOPPP; Pancreatic polypeptide prohormone; Pancreatic polypeptide Y; PH; PP1; PPA1; PPase; prepro-PP (prepropancreatic polypeptide); SID6-8061
Gene Aliases: PNP; PP; PPY
UniProt ID: (Human) P01298
Entrez Gene ID: (Human) 5539
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support