Search
Invitrogen
Human ATP5A1 (aa 206-290) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102896
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
QRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83505. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The ATP5F1A gene (ATP Synthase F1 Subunit Alpha) is located on chromosome 18q21.33 and encodes a critical component of the mitochondrial ATP synthase complex, specifically the F1 catalytic core. The ATP synthase complex is essential for cellular energy production, facilitating the conversion of ADP to ATP during oxidative phosphorylation. The ATP5F1A subunit is responsible for the catalysis of ATP synthesis driven by the proton gradient across the inner mitochondrial membrane. Dysfunctions or mutations in ATP5F1A can result in mitochondrial disorders and are linked to various metabolic and neurodegenerative diseases. Understanding the structure and function of ATP5F1A is vital for comprehending the bioenergetics of cellular respiration and has implications in studying mitochondrial pathologies.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATP synthase alpha chain, mitochondrial; ATP synthase F(1) complex subunit alpha, mitochondrial; ATP synthase F1 subunit alpha; ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle; ATP sythase (F1-ATPase) alpha subunit; epididymis secretory sperm binding protein Li 123m; iso; mitochondrial ATP synthetase, oligomycin-resistant; unnamed protein product
Gene Aliases: ATP5A; ATP5A1; ATP5AL2; ATP5F1A; ATPM; COXPD22; hATP1; HEL-S-123m; MC5DN4; MC5DN4A; MC5DN4B; MOM2; OMR; ORM
UniProt ID: (Human) P25705
Entrez Gene ID: (Human) 498
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support