Search
Invitrogen
Human IL18BP (aa 113-194) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102904
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59412. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Interleukin-18 binding protein (IL-18BP) is a constitutively secreted glycoprotein that acts as a natural antagonist for interleukin-18 (IL-18) by preventing interaction between IL-18 and its receptors. Through this binding, IL-18BP neutralizes the proinflammatory role of IL-18 in cell-mediated immune responses, resulting in reduced IFN-gamma production by T helper type I cells and inhibition of allospecific cytotoxic T lymphocyte (CTL) activity through augmented natural killer (NK) cell cytotoxicity. As an inhibitor of IL-18 and an essential component of skin homeostasis, IL-18BP has been linked to a variety of diseases, including eczema, asthma, and the autoimmune condition, Crohn's disease. The upregulation of IL-18BP by keratinocytes expressing the human papillomavirus (HPV) E7 oncoprotein has been shown to decrease IL-18-induced IFN-gamma production and IL-18-mediated T cell activation. Elevated levels of IL-18 and IL-18BP, as well as proinflammatory cytokines IFN-gamma, TNF-alpha, IL-1beta and IL-8, have been linked to chronic inflammation and observed in macrophages (including Kupffer cells) isolated from lesions and intestinal tissues of Crohn's disease patients. As a member of the immunoglobulin-like class of receptors, IL-18BP contains a single immunoglobulin (Ig) domain; although two (b and d) of the four identified human isoforms (a-d) contain incomplete domains that greatly reduce their binding affinity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: IL-18BP; IL-18BPa; IL-18BPb; IL-18BPc; Interleukin-18-binding protein; MC51L-53L-54L homolog gene product; Tadekinig-alfa; unnamed protein product
Gene Aliases: FVH; IL18BP; IL18BPa
UniProt ID: (Human) O95998
Entrez Gene ID: (Human) 10068
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support