Search
Invitrogen
Human CD10 (aa 121-210) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-103997
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VLQEPKTEDIVAVQKAKALYRSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111356. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD10, also known as the Common Acute Lymphocytic Leukemia Antigen (CALLA) and neutral endopeptidase (NEP), is a Zn2+-dependent metallo-peptidase with neutral metalloendopeptidase activity. It is a 100 kDa type II transmembrane glycoprotein encoded by a gene that exists in a single copy of greater than 45 kb. The 5' untranslated region of the CD10 gene is alternatively spliced, resulting in four separate mRNA transcripts, although the coding region remains unaffected by alternative splicing. CD10 is involved in the regulation of chemotactic and inflammatory processes involving neutrophils and plays a role in stromal cell-dependent B lymphopoiesis. It is expressed on immature B cells in adult bone marrow, mature B cells in germinal centers, and cells from patients with chronic myelocytic leukemia (CML). Additionally, CD10 is present on the cells of lymphoblastic, Burkitt's, and follicular germinal center lymphomas. Beyond the hematopoietic compartment, CD10 is highly expressed on the brush border of enterocytes and renal tubules and glomeruli, as well as on breast myoepithelial cells, bile canaliculi, and fibroblasts. CD10 cleaves peptides at the amino side of hydrophobic residues, inactivating several biologically active peptides, including endothelin, glucagon, gastrin, neurotensin, bradykinin, enkephalins, substance P, oxytocin, and others. Diseases associated with CD10 dysfunction include spinocerebellar ataxia 43 and Charcot-Marie Tooth Disease, highlighting its significance in both normal physiological processes and disease states.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Atriopeptidase; CALLA; CD10; common acute lymphoblastic leukemia antigen precursor; Common acute lymphocytic leukemia antigen; Enkephalinase; membrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA, CD10); NEP; NEP-390; NEP-411; Neprilysin; neprilysin-390; neprilysin-411; Neutral endopeptidase 24.11; SFE; Skin fibroblast elastase; unnamed protein product
Gene Aliases: CALLA; CD10; CMT2T; EPN; MME; NEP; SCA43; SFE
UniProt ID: (Human) P08473
Entrez Gene ID: (Human) 4311
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support