Search
Invitrogen
Human BNC1 (aa 779-866) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-107218
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66563. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Bnc 1 is a 994 amino acid transcription factor specific for squamous epithelium and for the constituent keratinocytes at a stage either prior to or at the very beginning of terminal differentiation. It is a zinc finger protein with three separated pairs of zinc fingers and a nuclear localization signal. Bnc 1 is a soluble protein that can shuttle between the nucleus and the cytoplasm, and its location depends on the proliferative potential of the cell. It is expressed relatively uniformly in the nucleoplasm, and phosphorylation on Ser-537 and Ser-541 leads to its cytoplasmic localization. It is present in the basal cell layer of the epidermis, in hair follicles and also in abundance in the germ cells of testis and ovary, and to a lower extent in thymus, spleen, mammary glands, placenta, brain and heart. Reports suggest that it plays a regulatory role in keratinocyte proliferation and also in rRNA transcription. It is also known to play a role in the differentiation of spermatozoa and oocytes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: basonuclin 1; bnc 1; unnamed protein product; Zinc finger protein basonuclin-1
Gene Aliases: bn1; BNC; BNC1; BSN1; HsT19447; POF16
UniProt ID: (Human) Q01954
Entrez Gene ID: (Human) 646
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support