Search
Invitrogen
Human ITGB1 (aa 625-712) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-108243
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84798. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD29, also known as ITGB1 or Integrin Subunit Beta 1, is a 110 kDa cell surface glycoprotein widely expressed by various cells, including all leukocytes. It forms non-covalently linked heterodimers with at least six different alpha integrins (CD49a-f), creating VLA-1 through VLA-6 complexes, as well as with CD51. These alpha-beta integrin heterodimers mediate a range of cellular responses, including adhesion, trafficking, proliferation, and differentiation. CD29-containing integrins bind to extracellular matrix proteins such as collagen, laminin, fibronectin, and vitronectin. Some integrins also interact with cellular receptors like VCAM-1 and MadCAM-1. CD29 plays a crucial role in immune cell trafficking from blood to tissue, particularly during leukocyte emigration and extravascular migration. It is involved in regulating tissue damage and disease symptoms related to inflammatory bowel disease. In the presence of anti-tumor drugs, decreased expression of ITGB1 correlates with multidrug resistance in tumor cells. ITGB1-dependent mechanisms enhance cytokine secretion in human airway smooth muscle in response to IL-1beta, facilitated by fibronectin and type I collagen. More than eight beta subunits with numerous splice variant isoforms have been identified in mammals, including two major forms: beta1A and beta1D. Beta1A is present in all tissues except cardiac and skeletal muscle, which express the beta1D variant.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: glycoprotein IIa; integrin beta 1; integrin beta-1 subunit (cytoplasmic domain); Integrin beta1; integrin VLA-4 beta subunit; integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12); ITBG1D; unnamed protein product; very late activation protein, beta polypeptide
Gene Aliases: CD29; FNRB; GPIIA; MDF2; MSK12; VLA-BETA; VLAB
UniProt ID: (Human) P05556
Entrez Gene ID: (Human) 3688
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support