Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD103 (aa 32-163) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-108890
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140223. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD103, also known as ITGAE or Integrin alpha E, is a molecule that non-covalently associates with integrin beta 7 to form a heterodimeric integral membrane protein. This protein is part of the integrin family, characterized by an alpha chain and a beta chain. Specifically, CD103 includes a 150 kDa alpha chain and a 120 kDa beta chain, with the alpha integrin undergoing post-translational cleavage in the extracellular domain to yield disulfide-linked heavy and light chains. CD103 is primarily expressed on mucosa-associated T lymphocytes, intraepithelial lymphocytes (IELs), and activated cells, as well as a subset of TGF beta-1 cells. It is preferentially found in human intestinal IELs, where it plays a role in adhesion and may serve as an accessory molecule for IEL activation. CD103 binds to epithelial cell antigen E-cadherin, mediating the homing of lymphocytes to the intestinal epithelium. In peripheral blood and lymphoid organs, CD103 is expressed by 0.5 to 2% of resting lymphocytes, and its expression can be upregulated in vitro by stimulating human T cells with mitogens. CD103 is also expressed by hairy cell leukemia (HCL) and some chronic B cell lymphocytic leukemias. The CD103 antibody stains a few bone marrow cells and, rarely, peripheral blood lymphocytes. Diseases associated with CD103 dysfunction include hairy cell leukemia and splenic marginal zone lymphoma.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: antigen CD103; antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide; CD103; DC; DCs; HML-1 antigen; human mucosal lymphocyte antigen 1, alpha polypeptide; integrin alpha E; Integrin alpha-E; Integrin alpha-IEL; integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide); Intregrin alpha E2; MGC141996; Mucosal lymphocyte 1 antigen
Gene Aliases: CD103; HUMINAE; ITGAE
UniProt ID: (Human) P38570
Entrez Gene ID: (Human) 3682
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support