Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human ASAP2 Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-109959
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144952. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
ASAP2 is a multidomain protein belonging to the beta family with two ANK repeats, an Arf-GAP domain, a PH domain and a SH3 domain. This protein localizes in the Golgi apparatus and also at the plasma membrane where it colocalizes with protein tyrosine kinase 2-beta (PYK2) and forms a stable complex with PYK2 in vivo. ASAP2 is tyrosine phosphorylated by activated PYK2. It functions as a substrate and downstream target for PYK2 and SRC, a pathway that may be involved in the regulation of vesicular transport. ASAP2 activates the small GTPases ARF1, ARF5 and ARF6 and regulates the formation of post-Golgi vesicles and modulates constitutive secretion. It modulates phagocytosis mediated by Fc gamma receptor and ARF6. Usually detected in heart, brain, placenta, kidney, monocytes and pancreas, it is up-regulated during monocyte maturation. Multiple transcript variants encoding different isoforms have been found.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2; centaurin, beta 3; development and differentiation enhancing factor 2; Development and differentiation-enhancing factor 2; PAG3; PAP; PAPbeta; Paxillin-associated protein with ARF GAP activity 3; PYK2 C terminus-associated protein; Pyk2 C-terminus-associated protein
Gene Aliases: AMAP2; ASAP2; CENTB3; DDEF2; KIAA0400; PAG3; PAP; Pap-alpha; SHAG1
UniProt ID: (Human) O43150
Entrez Gene ID: (Human) 8853
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support