Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human GATM (aa 24-157) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-88601
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55286. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
AGAT, also known as glycine amidinotransferase (L-arginine:glycine amidinotransferase), GATM or transamidinase, is a 423 amino acid protein belonging to the amidinotransferase family. Encoded by a gene that maps to human chromosome 15q21.1, AGAT exists as three alternatively spliced isoforms and consists of a homodimer, with equilibrium between monomeric and dimeric forms favoring a monomer subunit structure. AGAT localizes to mitochondrial inner membranes, peripheral membranes and cytoplasm. Biallelically expressed in placenta and fetal tissues, AGAT is also expressed in brain, heart, liver, lung, salivary gland and skeletal muscle tissue, with high expression in kidney. AGAT is elevated in the myocardium during heart failure and is decreased in inter-uterine growth restriction (IUGR)-associated placenta. AGAT catalyzes biosynthesis of guanidinoacetate, the immediate precursor of creatine, which plays a vital role in energy metabolism in muscle tissues. AGAT defects are associated with arginine:glycine amidinotransferase deficiency, an autosomal recessive disorder characterized by developmental delay or regression, mental retardation, severe disturbance of expressive and cognitive speech and severe depletion of creatine/phosphocreatine in brain. AGAT may be linked to embryonic and central nervous system development and may function in heart failure response by elevating local creatine synthesis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: glycine amidinotransferase (L-arginine:glycine amidinotransferase); Glycine amidinotransferase, mitochondrial; L-arginine:glycine amidinotransferase; testicular secretory protein Li 19; Transamidinase
Gene Aliases: AGAT; AT; CCDS3; GATM
UniProt ID: (Human) P50440
Entrez Gene ID: (Human) 2628
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support