Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human NPAS3 (aa 185-285) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89054
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
SQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Neuronal PAS domain protein 3 (NPAS3) is a brain-enriched basic helix-loop-helix PAS domain transcription factor and is broadly expressed in the developing neuroepithelium and has recently found to be disrupted by genetic translocation in a family affected with schizophrenia. It was recently shown to be involved in the regulation of FGF signaling in the dentate gyrus by controlling the expression of the FGF receptor subtype 1 and in turn neurogenesis emanating from this region. NPAS3-null mice were growth-retarded and displayed brain defects that included reduced size of the anterior hippocampus, hypoplasia of the corpus callosum, and enlargement of the ventricles, as well as several behavioral abnormalities. Furthermore, these NPAS3-null mice also exhibited disruptions in several neurosignaling pathways involving glutamate, dopamine, and serotonin. These results demonstrate the essential role played by NPAS3 during structural and functional brain development. At least three isoforms of NPAS3 are known to exist.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Basic-helix-loop-helix-PAS protein MOP6; bHLHe12; Class E basic helix-loop-helix protein 12; Member of PAS protein 6; Neuronal PAS domain-containing protein 3; Neuronal PAS3; PAS domain-containing protein 6
Gene Aliases: BHLHE12; MOP6; NPAS3; PASD6
UniProt ID: (Human) Q8IXF0
Entrez Gene ID: (Human) 64067
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support