Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Western Blot Products
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Food and Beverage
    • Lab Solutions
    • Pharma and Biopharma
    • Real-Time PCR
    • Semiconductor Analysis
    • Clinical and Diagnostics
    • Digital Solutions
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • See all services
  • Help and Support
    • Order Help
    • Digital Solutions
    • Product Support
    • Technical Information
    • Training and Education
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Proteins & Peptides ›
          • ZCCHC6 Proteins

          Invitrogen

          Human ZCCHC6 (aa 734-837) Control Fragment Recombinant Protein

          View all (2) ZCCHC6 proteins

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Tech Support
          Datasheet
          Certificates
          Tech Support
          Datasheet
          Certificates
          Tech Support

          Cite Human ZCCHC6 (aa 734-837) Control Fragment Recombinant Protein

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}

          Product Details

          RP-92886

          Applications
          Tested Dilution
          Publications

          Neutralization (Neu)

          Assay-dependent
          -
          Product Specifications

          Species

          Human

          Expression System

          E. coli

          Amino acid sequence

          DDYKGDKVYHPETGRKNEKEKVGRKGKHLLTVDQKRGEHVVCGSTRNNESESTLDLEGFQNPTAKECEGLATLDNKADLDGESTEGTEELEDSLNHFTHSVQGQ

          Tag

          His-ABP-tag

          Class

          Recombinant

          Type

          Protein

          Purity

          >80% by SDS-PAGE and Coomassie blue staining

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          ≥5.0 mg/mL

          Purification

          purified

          Storage buffer

          PBS/1M urea, pH 7.4

          Contains

          no preservative

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Wet ice

          Product Specific Information

          Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%).

          This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

          Target Information

          Uridylyltransferase that mediates the terminal uridylation of mRNAs with short (less than 25 nucleotides) poly(A) tails, hence facilitating global mRNA decay (PubMed:19703396, PubMed:25480299). Essential for both oocyte maturation and fertility. Through 3' terminal uridylation of mRNA, sculpts, with TUT7, the maternal transcriptome by eliminating transcripts during oocyte growth. Involved in microRNA (miRNA)-induced gene silencing through uridylation of deadenylated miRNA targets (PubMed:25480299). Also functions as an integral regulator of microRNA biogenesiS using 3 different uridylation mechanisms (PubMed:25979828). Acts as a suppressor of miRNA biogenesis by mediating the terminal uridylation of some miRNA precursors, including that of let-7 (pre-let-7). Uridylated pre-let-7 RNA is not processed by Dicer and undergo degradation. Pre-let-7 uridylation is strongly enhanced in the presence of LIN28A (PubMed:22898984). In the absence of LIN28A, TUT7 and TUT4 monouridylate group II pre-miRNAs, which includes most of pre-let7 members, that shapes an optimal 3' end overhang for efficient processing (PubMed:25979828, PubMed:28671666). Add oligo-U tails to truncated pre-miRNAS with a 5' overhang which may promote rapid degradation of non-functional pre-miRNA species (PubMed:25979828). Does not play a role in replication-dependent histone mRNA degradation (PubMed:18172165). Due to functional redundancy between TUT4 and TUT7, the identification of the specific role of each of these proteins is difficult (PubMed:25979828, PubMed:25480299, PubMed:19703396, PubMed:22898984, PubMed:18172165, PubMed:28671666). TUT4 and TUT7 restrict retrotransposition of long interspersed element-1 (LINE-1) in cooperation with MOV10 counteracting the RNA chaperonne activity of L1RE1. TUT7 uridylates LINE-1 mRNAs in the cytoplasm which inhibits initiation of reverse transcription once in the nucleus, whereas uridylation by TUT4 destabilizes mRNAs in cytoplasmic ribonucleoprotein granules (PubMed:30122351). [UniProt]

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: FLJ13409; PAP associated domain containing 6; Terminal uridylyltransferase 7; TUTase 7; TUTase7; unnamed protein product; Zinc finger CCHC domain-containing protein 6; zinc finger CCHC-type containing 6; zinc finger, CCHC domain containing 6

          View more View less

          Gene Aliases: HS2; KIAA1711; PAPD6; TENT3B; TUT7; ZCCHC6

          View more View less

          UniProt ID: (Human) Q5VYS8

          View more View less

          Entrez Gene ID: (Human) 79670

          View more View less

          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Taiwan flag icon
          Taiwan

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-454p7:80/100.66.72.101:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline