Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human NEFM (aa 115-238) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-93757
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82815. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Neurofilaments (NFs) are a type of intermediate filament (IF) expressed almost exclusively in neuronal cells, and in those cells most prominently in large axons. NFs, in most vertebrates, are composed of three different polypeptide chains with different molecular weights - neurofilament medium protein (NF-M), high (NF-H) and light protein (NF-L), which share sequence and structural similarity in a coiled-coil core domain, but differ in the length and sequence of their N-termini and more dramatically of their C-termini which in the case of NF-M and NF-H form the flexible extensions that link NFs to each other and to other elements in the cytoplasm. NF-M protein tail-mediated interactions of neurofilaments are critical for size and cytoskeletal architecture of axons, and are mediated, in part, by the highly phosphorylated tail domain of this protein. NF-M phosphorylation and O-GlcNAcylation are regulated reciprocally and affect its translocation and filament formation and function. Antibodies to the various neurofilament subunits are very useful cell type markers since the proteins are among the most abundant of the nervous system, are expressed only in neurons and are biochemically very stable.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 160 kDa neurofilament protein; NEFM; Neurofilament 3; Neurofilament medium polypeptide; Neurofilament triplet M protein; neurofilament, medium polypeptide 150kDa; neurofilament-3 (150 kD medium); NF-M; NMC
Gene Aliases: NEF3; NEFM; NF-M; NFM
UniProt ID: (Human) P07197
Entrez Gene ID: (Human) 4741
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support