Search
Invitrogen
Human SLC34A1 Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-98434
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PLPVPGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQA
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62358. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Renal tubular reabsorption of phosphate is critical to the maintenance of phosphate homeostasis in mammals. The brush-border membrane Na+/Pi cotransport systems in proximal tubules play a major role in this process. The renal Na(+)/P(i) cotransporter NPT2 is expressed in the brush border membrane (BBM) of proximal tubular cells. NPT2 gene expression is crucial for PTH effects on renal P(i) handling. However, renal expression of the sodium/phosphate cotransporter gene, NPT2, is not required for regulation of renal 1 alpha-hydroxylase by phosphate. NPT2 is an integral membrane protein expressed in kidney and lung. The gene encoding human NPT1 maps to chromosome 6q21.3-p23, while the gene encoding human NPT2 maps to chromosome 5q35.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Na(+)-dependent phosphate cotransporter 2A; Na(+)/Pi cotransporter 2A; Na+-phosphate cotransporter type II; naPi-2a; NaPi-3; renal sodium-dependent phosphate transporter; Sodium-dependent phosphate transport protein 2A; Sodium-phosphate transport protein 2A; sodium/phosphate co-transporter; Sodium/phosphate cotransporter 2A; solute carrier family 17 (sodium phosphate), member 2; solute carrier family 34 (sodium phosphate), member 1; solute carrier family 34 (type II sodium/phosphate cotransporter), member 1; Solute carrier family 34 member 1; unnamed protein product
Gene Aliases: FRTS2; HCINF2; NAPI-3; NPHLOP1; NPT2; NPTIIa; SLC11; SLC17A2; SLC34A1
UniProt ID: (Human) Q06495
Entrez Gene ID: (Human) 6569
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support