Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Estatus del pedido
            • Productos personalizados y proyectos​
          • Primary Antibodies ›
          • RAGE Antibodies

          Invitrogen

          RAGE Polyclonal Antibody

          Advanced Verification
          2 References
          View all (31) RAGE antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite RAGE Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (5)
          • Advanced Verification (1)
          RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RAGE Antibody (PA5-78736) in IHC (P)

          Immunohistochemistry analysis of RAGE on paraffin-embedded human intestinal cancer tissue. Sample was incubated with RAGE polyclonal antibody (Product# PA5-78736). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAGE Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RAGE Antibody in Western Blot (WB)
          RAGE Antibody in Western Blot (WB)
          RAGE Antibody
          RAGE Polyclonal Antibody

          Product Details

          PA5-78736

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human RAGE (91-120aa IQDEGIFRCQAMNRNGKETKSNYRVRVYQI).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745852

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Lung Tissue, RH35 whole cell, HELA whole cell. IHC: mouse lung tissue, rat lung tissue, human intestinal cancer tissue.

          Target Information

          The Receptor for Advanced Glycation End-products (RAGE) is a gene located on human chromosome 6p21.3, encoding a transmembrane receptor belonging to the immunoglobulin superfamily. RAGE is expressed in various tissues, with significant levels in the lungs, and plays a crucial role in cellular signaling and inflammation. As a receptor, RAGE binds multiple ligands, including advanced glycation end-products (AGEs), amyloid-beta peptide, high mobility group box 1 (HMGB1), and S100/calgranulin proteins, facilitating diverse pathological processes like inflammation, cancer progression, and neurodegeneration. The interaction between RAGE and its ligands triggers intracellular signaling pathways such as NF-kB activation, leading to inflammatory responses and oxidative stress. In the context of chronic diseases like diabetes, Alzheimer's, and cardiovascular diseases, RAGE is a critical mediator, linking metabolic disturbance to cellular dysfunction. Therapeutic targeting of RAGE signaling is under investigation, aiming to mitigate its contribution to inflammatory and degenerative diseases.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: advanced glycation end-products receptor; advanced glycosylation end product receptor; Advanced glycosylation end product-specific receptor; advanced glycosylation end product-specific receptor variant 2; advanced glycosylation end product-specific receptor variant 3; advanced glycosylation end product-specific receptor variant 4; advanced glycosylation end product-specific receptor variant 5; RAGE-4 ORF3; RAGEdelex2-6; RAGEdelex3; RAGEdelex3-10; RAGEdelex3-7; RAGEdelex8&int9; RAGEint4; RAGEint4&9; RAGEint9&delex11; RAGEv1; RAGEv8; receptor for advanced glycation end-products; receptor for advanced glycation end-products variant 20; Receptor for advanced glycosylation end products; soluble receptor; sRAGE; unnamed protein product

          View more View less

          Gene Aliases: AGER; RAGE; SCARJ1; sRAGE

          View more View less

          UniProt ID: (Human) Q15109, (Mouse) Q62151

          View more View less

          Entrez Gene ID: (Human) 177, (Rat) 81722, (Mouse) 11596

          View more View less

          Function(s)
          beta-amyloid binding DNA binding RNA binding transmembrane signaling receptor activity scavenger receptor activity laminin receptor activity protein binding signaling receptor activity histone binding identical protein binding S100 protein binding macromolecular complex binding advanced glycation end-product receptor activity binding, bridging high mobility group box 1 binding cell adhesion molecule immunoglobulin superfamily cell adhesion molecule
          Process(es)
          response to hypoxia microglial cell activation positive regulation of cytokine production regulation of T cell mediated cytotoxicity DNA replication DNA repair phagocytosis inflammatory response cellular response to DNA damage stimulus cell adhesion cell surface receptor signaling pathway learning or memory positive regulation of cell proliferation response to wounding negative regulation of biosynthetic process glucose mediated signaling pathway astrocyte development regulation of cell adhesion positive regulation of cell migration neuron projection development negative regulation of interleukin-10 production positive regulation of chemokine production positive regulation of interleukin-1 beta production positive regulation of interleukin-12 production positive regulation of interleukin-6 production positive regulation of tumor necrosis factor production positive regulation of heterotypic cell-cell adhesion positive regulation of activated T cell proliferation transcytosis positive regulation of cell differentiation positive regulation of JNK cascade astrocyte activation regulation of synaptic plasticity regulation of inflammatory response induction of positive chemotaxis positive regulation of DNA metabolic process positive regulation of NF-kappaB transcription factor activity negative regulation of multicellular organismal process positive regulation of ERK1 and ERK2 cascade cellular response to glucose stimulus positive regulation of monocyte chemotactic protein-1 production protein localization to membrane regulation of spontaneous synaptic transmission transport across blood-brain barrier regulation of long-term synaptic potentiation negative regulation of long-term synaptic potentiation negative regulation of long term synaptic depression regulation of p38MAPK cascade positive regulation of p38MAPK cascade regulation of NIK/NF-kappaB signaling positive regulation of NIK/NF-kappaB signaling positive regulation of amyloid precursor protein catabolic process negative regulation of blood circulation positive regulation of endothelin production negative regulation of connective tissue replacement involved in inflammatory response wound healing response to amyloid-beta cellular response to beta-amyloid positive regulation of DNA-dependent DNA replication positive regulation of monocyte extravasation regulation of CD4-positive, alpha-beta T cell activation positive regulation of double-strand break repair positive regulation of dendritic cell differentiation negative regulation of protein phosphorylation positive regulation of protein phosphorylation negative regulation of endothelial cell proliferation negative regulation of cell adhesion JAK-STAT cascade brain development glycoprotein metabolic process response to fructose positive regulation of autophagy negative regulation of endothelial cell migration positive regulation of gene expression positive regulation of epithelial to mesenchymal transition positive regulation of fibroblast migration response to activity positive regulation of smooth muscle cell migration lung development negative regulation of collagen biosynthetic process response to vitamin A response to genistein negative regulation of osteoblast proliferation cellular response to drug positive regulation of apoptotic process positive regulation of JUN kinase activity positive regulation of neuron apoptotic process positive regulation of fibroblast proliferation positive regulation of smooth muscle cell proliferation positive regulation of inflammatory response regulation of DNA binding response to methylglyoxal calcium ion homeostasis response to hyperoxia positive regulation of phagocytosis, engulfment transdifferentiation cellular response to hydrogen peroxide cellular response to fatty acid cellular response to organic cyclic compound response to selenite ion positive regulation of potassium ion transmembrane transporter activity positive regulation of neuron death positive regulation of endothelial cell apoptotic process positive regulation of reactive oxygen species metabolic process positive regulation of type B pancreatic cell apoptotic process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-zsnhf:80/100.66.75.14:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline