Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Estatus del pedido
            • Productos personalizados y proyectos​
          • Primary Antibodies ›
          • Aquaporin 1 Antibodies

          Invitrogen

          Aquaporin 1 Polyclonal Antibody

          3 Published Figures
          3 References
          View all (25) Aquaporin 1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Aquaporin 1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (6)
          • Published Figures (3)
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 9

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Aquaporin 1 Antibody (PA5-78806) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of Aquaporin 1 in paraffin-embedded section of rat kidney tissue using Aquaporin 1 Polyclonal Antibody (Product # PA5-78806). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overni... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Western Blot (WB)
          Aquaporin 1 Antibody in Flow Cytometry (Flow)
          Aquaporin 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Aquaporin 1 Antibody in Immunohistochemistry, Immunohistochemistry (Paraffin) (IHC, IHC (P))
          Aquaporin 1 Antibody in Flow Cytometry (Flow)
          Aquaporin 1 Polyclonal Antibody

          Product Details

          PA5-78806

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          View 1 publication 1 publication

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Hamster, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745922

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat heart tissue, rat kidney tissue, rat lung tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue. IHC: human kidney tissue, mouse kidney tissue, rat kidney tissue. Flow: U2OS cell.

          Target Information

          Aquaporin 1 is a 28kD integral membrane protein which was originally identified in red blood cells and renal proximal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 28 kda erythrocyte integral membrane protein homolog; AQP 1; AQP CHIP; AQP-1; Aquaporin 1 (aquaporin channel forming integral protein 28 (CHIP)); aquaporin 1 (channel-forming integral protein, 28kDa, CO blood group); aquaporin 1, Colton blood group antigen; Aquaporin CHIP; Aquaporin-1; Aquaporin-CHIP; Aquaporin1; bloodgroup CO protein; Channel-like integral membrane protein of 28 kDa; channel-like integral membrane protein, 28-kDa; CHIP 28; Colton blood group; Colton blood group antigen; Delayed early response protein 2; DER2; growth factor-induced delayed early response protein; MGC26324; unnamed protein product; Urine water channel; water channel protein for red blood cells and kidney proximal tubule

          View more View less

          Gene Aliases: AQP-CHIP; AQP1; CHIP28; CO

          View more View less

          UniProt ID: (Human) P29972, (Mouse) Q02013, (Rat) P29975

          View more View less

          Entrez Gene ID: (Human) 358, (Mouse) 11826, (Rat) 25240

          View more View less

          Function(s)
          intracellular cGMP activated cation channel activity potassium channel activity water transmembrane transporter activity protein binding ammonium transmembrane transporter activity potassium ion transmembrane transporter activity glycerol transmembrane transporter activity water channel activity channel activity transmembrane transporter activity nitric oxide transmembrane transporter activity carbon dioxide transmembrane transporter activity identical protein binding ephrin receptor binding hydrogen peroxide channel activity transporter activity glycerol channel activity transporter
          Process(es)
          renal water homeostasis glomerular filtration renal water transport potassium ion transport water transport cell volume homeostasis hyperosmotic response cellular water homeostasis fibroblast migration positive regulation of fibroblast migration carbon dioxide transport glycerol transport cell migration sensory perception of pain cellular homeostasis cGMP-mediated signaling lateral ventricle development pancreatic juice secretion nitric oxide transport establishment or maintenance of actin cytoskeleton polarity secretion by cell cerebrospinal fluid secretion secretory granule organization cellular response to UV transepithelial water transport carbon dioxide transmembrane transport wound healing odontogenesis negative regulation of apoptotic process lipid digestion positive regulation of angiogenesis positive regulation of saliva secretion positive regulation of fibroblast proliferation camera-type eye morphogenesis defense response to Gram-negative bacterium multicellular organismal water homeostasis corticotropin secretion establishment of localization in cell transmembrane transport renal water absorption cellular response to hydrogen peroxide cellular response to mechanical stimulus cellular response to copper ion cellular response to mercury ion cellular response to retinoic acid cellular response to cAMP cellular response to hypoxia cellular response to salt stress cellular hyperosmotic response cellular response to dexamethasone stimulus cellular response to nitric oxide potassium ion transmembrane transport metanephric descending thin limb development metanephric proximal straight tubule development metanephric proximal convoluted tubule segment 2 development metanephric glomerulus vasculature development ammonium transmembrane transport hydrogen peroxide transmembrane transport cation transmembrane transport cGMP biosynthetic process transport positive regulation of lamellipodium assembly positive regulation of epithelial cell migration organic cation transport ammonium transport water homeostasis positive regulation of cell migration cellular response to stress carbohydrate transmembrane transport response to drug negative regulation of cysteine-type endopeptidase activity involved in apoptotic process cellular response to inorganic substance maintenance of symbiont-containing vacuole by host response to hormone hyperosmotic salinity response response to estrogen
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-x75fr:80/100.66.77.4:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline