Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • CRB1 Antibodies

          Invitrogen

          CRB1 Polyclonal Antibody

          View all (6) CRB1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite CRB1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (6)
          CRB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          CRB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CRB1 Antibody (PA5-143856) in IHC (P)

          Immunohistochemistry analysis of CRB1 in paraffin-embedded section of human testis cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH 6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. Samples were incubated with CRB1 Polyclonal antibody (Product # PA5-143856) using a dilution of 1 μg/mL overnight at 4°C. Biotinylated goat anti-ra... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CRB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CRB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CRB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CRB1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CRB1 Antibody in Western Blot (WB)
          CRB1 Antibody in Flow Cytometry (Flow)
          CRB1 Polyclonal Antibody

          Product Details

          PA5-143856

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human CRB1 (FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_3075070

          Product Specific Information

          Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

          Positive Control - WB: human HEK293 whole cell, human U-87MG whole cell. IHC: mouse testis tissue, human testis cancer tissue, rat testis tissue, human glioma tissue. Flow: U87 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          CRB1 (Crumbs homolog 1) plays a role in photoreceptor morphogenesis in the retina. It may maintain cell polarization and adhesion. CRB1 is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. The first identified human homolog, CRB1, is expressed in retina and some parts of the brain, leaving room for another homolog to function in epithelial tissues. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: crumbs 1, cell polarity complex component; crumbs family member 1, photoreceptor morphogenesis associated; Crumbs homolog 1; Protein crumbs homolog 1; retina-specific; similar to Drosophila crumbs protein; similar to Drosophila CRUMBS protein; unnamed protein product

          View more View less

          Gene Aliases: 7530426H14Rik; A930008G09Rik; CRB1; CRB1-A; CRB1-B; CRB1-C; LCA8; RP12

          View more View less

          UniProt ID: (Human) P82279, (Mouse) Q8VHS2

          View more View less

          Entrez Gene ID: (Human) 23418, (Rat) 304825, (Mouse) 170788

          View more View less

          Function(s)
          calcium ion binding protein binding molecular_function cell adhesion molecule
          Process(es)
          blood vessel remodeling plasma membrane organization cell communication heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules establishment or maintenance of cell polarity cell-cell signaling visual perception protein localization glial cell differentiation gene expression retina layer formation signaling photoreceptor cell outer segment organization eye photoreceptor cell development establishment or maintenance of epithelial cell apical/basal polarity photoreceptor cell maintenance detection of light stimulus involved in visual perception retina development in camera-type eye retina morphogenesis in camera-type eye post-embryonic retina morphogenesis in camera-type eye membrane organization establishment of bipolar cell polarity involved in cell morphogenesis cellular response to light stimulus biological_process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-b2k9d:80/100.66.79.173:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline