Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Ver todas las categorías de producto
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Pedidos
            • Productos y proyectos personalizados
          • Primary Antibodies ›
          • Ku70 Antibodies

          Invitrogen

          Ku70 Polyclonal Antibody

          View all (33) Ku70 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Ku70 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (18)
          Ku70 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          Ku70 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 18

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Ku70 Antibody (PA5-95270) in ICC/IF

          Immunocytochemistry/Immunofluorescence analysis of Ku70 in U2OS cell using Ku70 Polyclonal Antibody (Product # PA5-95270). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL and mouse anti-Beta Tubulin antibody overnight at 4°C. Cy3 conjugated goat anti-rabbit IgG and FITC conjugated goat anti-mouse IgG were used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. Visualized usi... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Ku70 Antibody in Immunocytochemistry (ICC/IF)
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Ku70 Antibody in Western Blot (WB)
          Ku70 Antibody in Flow Cytometry (Flow)
          Ku70 Polyclonal Antibody

          Product Details

          PA5-95270

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807074

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human LNCAP whole cell, human Hela whole cell, human 293T whole cell, human HepG2 whole cell, human Jurkat whole cell, human K562 whole cell, human A549 whole cell, human A431 whole cell. IHC: human bladder cancer tissue, human bladder cancer tissue, human colon adenocarcinoma tissue, human colon adenocarcinoma tissue, human glioblastoma tissue, human glioblastoma tissue, human liver cancer tissue, human liver cancer tissue, human lung adenocarcinoma tissue, human lung adenocarcinoma tissue, human pancreas ductal adenocarcinoma tissue, human pancreas ductal adenocarcinoma tissue, human testicular seminoma tissue, human testicular seminoma tissue. ICC/IF: U2OS cell. Flow: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          XRCC6 is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CT; CTA-216E10.7; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; DNA repair protein Ku70; DNA repair protein XRCC6; G22P1; Ku autoantigen p70 subunit; Ku autoantigen, 70kDa; Ku protein subunit; Ku70; Lupus Ku autoantigen protein p70; OTTHUMP00000028581; p70 autoantigen; thyroid autoantigen; thyroid autoantigen 70kD (Ku antigen); thyroid autoantigen 70kDa (Ku antigen); Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; unnamed protein product; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair cross-complementing protein 6

          View more View less

          Gene Aliases: CTC75; CTCBF; G22P1; KU70; ML8; TLAA; XRCC6

          View more View less

          UniProt ID: (Human) P12956

          View more View less

          Entrez Gene ID: (Human) 2547

          View more View less

          Function(s)
          nucleotide binding transcription regulatory region sequence-specific DNA binding DNA binding DNA helicase activity damaged DNA binding double-stranded DNA binding double-stranded telomeric DNA binding RNA binding catalytic activity helicase activity protein binding ATP binding DNA-dependent ATPase activity hydrolase activity lyase activity ATPase activity cyclin binding telomeric DNA binding macromolecular complex binding DNA end binding 5'-deoxyribose-5-phosphate lyase activity scaffold protein binding
          Process(es)
          telomere maintenance recombinational repair activation of innate immune response immune system process positive regulation of immune system process DNA repair double-strand break repair via nonhomologous end joining DNA recombination cellular response to DNA damage stimulus response to ionizing radiation negative regulation of macromolecule biosynthetic process innate immune response positive regulation of lymphocyte differentiation positive regulation of protein kinase activity negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter regulation of smooth muscle cell proliferation cellular hyperosmotic salinity response cellular response to gamma radiation cellular response to X-ray double-strand break repair via classical nonhomologous end joining
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-x75fr:80/100.66.77.4:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline