Search
Invitrogen
Sorcin Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 9
Sorcin Antibody (PA5-95611) in ICC/IF
Immunocytochemistry analysis of SRI using anti-SRI antibody (Product # PA5-95611) . SRI was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-SRI antibody (Product # PA5-95611) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize... View More
Product Details
PA5-95611
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human placenta tissue, human U20S whole cell, human A431 whole cell, human PC-3 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, rat lung tissue, mouse lung tissue. IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue. ICC/IF: U20S cell. Flow: SiHa cell, U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Sorcin is a 198 amino acid, soluble, resistance-related, calcium-binding cytosolic protein belonging to the penta-EF hand (PEF) family of calcium binding proteins and contains 4 EF-hand calcium-binding motifs. Human Sorcin is known to share 95% sequence identity with hamster Sorcin. It is known to associate with the sarcolemmal proteins Annexin VII, cardiac ryanodine receptors and L-type Ca2+ channels and thus influence the intracellular Ca (2+)-homeostasis. It is also important in the regulation of intracellular Ca2+ cycling and Ca2+ influx pathways in the heart and skeletal muscle during excitation-contraction. It is overproduced in many multi-drug resistance (MDR) cells and regulates cell apoptosis pathways, thus acting as a new MDR marker for prognosis of acute myeloid leukemia (AML) and a good target for anti-MDR drug development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: 22 kDa protein; calcium binding protein amplified in mutlidrug-resistant cells; CP-22; CP22; H_RG167B05.1; Sorcin; sorcin CP-22; unnamed protein product; V19
Gene Aliases: 2210417O06Rik; 2900070H08Rik; CP-22; CP22; SCN; Sor; SRI; V19
UniProt ID: (Human) P30626, (Mouse) Q6P069
Entrez Gene ID: (Human) 6717, (Mouse) 109552, (Rat) 683667
protease binding
receptor binding
calcium channel regulator activity
calcium ion binding
protein binding
identical protein binding
ion channel binding
metal ion binding
protein heterodimerization activity
DNA-binding transcription factor binding
protein sequestering activity
transcription regulator inhibitor activity
calcium-dependent cysteine-type endopeptidase activity
repressing transcription factor binding
actin or actin-binding cytoskeletal protein
calcium ion transport
signal transduction
negative regulation of heart rate
regulation of gene expression
regulation of cell communication by electrical coupling
regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
positive regulation of release of sequestered calcium ion into cytosol
regulation of calcium ion transport
negative regulation of cardiac muscle contraction
regulation of insulin secretion involved in cellular response to glucose stimulus
regulation of cardiac muscle cell contraction
regulation of relaxation of muscle
regulation of cell communication by electrical coupling involved in cardiac conduction
proteolysis
positive regulation of insulin secretion involved in cellular response to glucose stimulus
cytoplasmic sequestering of transcription factor
negative regulation of ryanodine-sensitive calcium-release channel activity
regulation of high voltage-gated calcium channel activity
negative regulation of transcription regulatory region DNA binding
heart development
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support