Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human AP2M1 (aa 357-435) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-96388
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The heterotetrameric coat assembly protein complex, also known as the adaptor-related protein complex 2 (AP-2), belongs to the adaptor complexes medium subunits family. The mu 1 subunit of the AP-2 complex (AP2M1) is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP2M1 has also been shown to associate with the HIV-1 protein Nef, suggesting that Nef may use AP-2 complex to enhance the rate of endocytosis of both CD4 and class I MHC. AP2M1 may also play an important role in regulating the intracellular trafficking and function of cytotoxic T-lymphocyte associated (CTLA)-4 protein. At least two isoforms of AP2M1 are known to exist.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Adaptin-mu2; Adaptor protein complex AP-2 subunit mu; adaptor related protein complex 2, mu 1 subunit; Adaptor-related protein complex 2 subunit mu; adaptor-related protein complex 2, mu 1 subunit; AP-2 complex subunit mu; AP-2 mu 2 chain; AP-2 mu chain; clathrin adaptor complex AP2, mu subunit; clathrin assembly protein complex 2 medium chain; Clathrin assembly protein complex 2 mu medium chain; clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; clathrin-associated/assembly/adaptor protein, medium 1; HA2 50 kDA subunit; Plasma membrane adaptor AP-2 50 kDa protein; plasma membrane adaptor AP-2 50kDA protein
Gene Aliases: AP2M1; AP50; CLAPM1; KIAA0109; mu2
UniProt ID: (Human) Q96CW1
Entrez Gene ID: (Human) 1173
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support