Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human ASH2L (aa 307-430) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102513
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEM
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The human ASH2L gene encodes a 628 amino acid protein known as ASH2L1, or isoform 1, which contains a nuclear localization signal and PHD finger motif, suggesting that the gene product functions as a transcription regulator. Its predicted molecular weight is 68.7kDa. Alternative splicing results in possible isoforms at 60 kDa & 56.5 kDa). Human ASH2L proteins are 60% homologous to Drosophila ash2, which positively regulates expression of certain genes in early development, and contain similar, but not identical, domains, including a zinc finger motif. Homology to mouse ASH2L is 90%. ASH2L is predominantly expressed in adult heart and testis and fetal lung and liver, with barely detectable expression in adult lung, liver, kidney, prostate, and peripheral leukocytes as well as leukemia cell lines with erythroid and megakaryocytic potential, such as K562, Hel and Dami. Differentiation inducers (e.g. phorbol ester and hemin) cause different expression patterns in these cell lines, suggesting that ASH2L plays a role in hematopoiesis and is associated with particular types of leukemia. In addition ASH2L has been suggested to interact with beta-tubulin and beta-catenin.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ASH 2; ash2 (absent, small, or homeotic)-like; ASH2 LIKE; ASH2 like protein; ASH2-like protein; Bre 2; Set1/Ash2 histone methyltransferase complex subunit ASH2
Gene Aliases: ASH2; ASH2L; ASH2L1; ASH2L2; Bre2
UniProt ID: (Human) Q9UBL3
Entrez Gene ID: (Human) 9070
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support