Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human ASK (aa 417-540) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-106034
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PHPSNELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Activator of S phase kinase (ASK, DBF4) is a novel regulatory subunit of the human Cdc7 kinase complex that plays a pivotal role in G1/S cell cycle transition in mammalian cells. The increase in Cdc7 kinase activity at the G1/S boundary is at least partly accounted for by the elevated expression of ASK in late G1. ASK interacts with replication origins in vivo, suggesting that Cdc7 may trigger S phase by directly activating the replication initiation complexes assembled at the origins. Human ASK protein levels are regulated during the cell cycle with a pattern that matches that of human Cdc7 protein kinase activity. Human Cdc7-ASK kinase is directly involved in regulating the initiation of DNA replication by targeting MCM2 protein in mammalian cells. Nuclear localization and chromatin binding of endogenous huCdc7 and GFP-ASK is presumably imported into nuclei through its two nuclear localization signals at telophase, it may require additional signals for chromatin binding, the level of which increases at late G1 ohase. A functional link may exist between menin, a tumor suppressor protein mutated in multiple endocrine neoplasia type I (MEN1), and ASK in the regulation of cell proliferation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Activator of S phase kinase; Chiffon homolog A; DBF4 homolog; DBF4 zinc finger A; DBF4-type zinc finger-containing protein 1; Protein DBF4 homolog A; zinc finger, DBF-type containing 1
Gene Aliases: ASK; CHIF; DBF4; DBF4A; ZDBF1
UniProt ID: (Human) Q9UBU7
Entrez Gene ID: (Human) 10926
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support