Search
Invitrogen
Human BRCA1 (aa 1743-1814) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-108212
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84339. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
BRCA1 (breast and ovarian cancer susceptibility protein 1) is a nuclear phosphoprotein that plays a role in maintaining genomic stability and acts as a tumor suppressor in combination with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as BASC (for BRCA1 associated genome surveillance complex). BRCA1 associates with RNA polymerase II, and through the C terminal domain, also interacts with histone deacetylase complex. The BRCA1 protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in the BRCA1 gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: brca 1; brca-1; BRCA1/BRCA2-containing complex, subunit 1; breast and ovarian cancer susceptibility protein 1; breast cancer 1 early onset; breast cancer 1, early onset; Breast cancer type 1 susceptibility protein; breast cancer type 1 susceptibility protein isoform p.23; breast cancer type 1 susceptibility protein, isoform p.10; breast cancer type 1 susceptibility protein, isoform p.11; breast cancer type 1 susceptibility protein, isoform p.12; breast cancer type 1 susceptibility protein, isoform p.13; breast cancer type 1 susceptibility protein, isoform p.14; breast cancer type 1 susceptibility protein, isoform p.15; breast cancer type 1 susceptibility protein, isoform p.16; breast cancer type 1 susceptibility protein, isoform p.17; breast cancer type 1 susceptibility protein, isoform p.18; breast cancer type 1 susceptibility protein, isoform p.19; breast cancer type 1 susceptibility protein, isoform p.20; breast cancer type 1 susceptibility protein, isoform p.21; breast cancer type 1 susceptibility protein, isoform p.22; breast cancer type 1 susceptibility protein, isoform p.24; breast cancer type 1 susceptibility protein, isoform p.25; breast cancer type 1 susceptibility protein, isoform p.26; breast cancer type 1 susceptibility protein, isoform p.27; breast cancer type 1 susceptibility protein, isoform p.28; breast cancer type 1 susceptibility protein, isoform p.29; breast cancer type 1 susceptibility protein, isoform p.30; breast cancer type 1 susceptibility protein, isoform p.31; breast cancer type 1 susceptibility protein, isoform p.32; breast cancer type 1 susceptibility protein, isoform p.33; breast cancer type 1 susceptibility protein, isoform p.34; breast cancer type 1 susceptibility protein, isoform p.35; breast cancer type 1 susceptibility protein, isoform p.36; breast cancer type 1 susceptibility protein, isoform p.37; breast cancer type 1 susceptibility protein, isoform p.38; breast cancer type 1 susceptibility protein, isoform p.39; breast cancer type 1 susceptibility protein, isoform p.40; breast cancer type 1 susceptibility protein, isoform p.41; breast cancer type 1 susceptibility protein, isoform p.42; breast cancer type 1 susceptibility protein, isoform p.6; breast cancer type 1 susceptibility protein, isoform p.7; breast cancer type 1 susceptibility protein, isoform p.8; breast cancer type 1 susceptibility protein, isoform p.9; BROVCA12; Delta772-3095; early onset breast cancer 1; Fanconi anemia, complementation group S; influences susceptibility to breast and ovarian cancer; OTTHUMP00000212147; OTTHUMP00000212148; OTTHUMP00000212149; OTTHUMP00000212150; OTTHUMP00000212151; OTTHUMP00000212155; protein phosphatase 1, regulatory subunit 53; RING finger protein 53; RING-type E3 ubiquitin transferase BRCA1; unnamed protein product
Gene Aliases: BRCA1; BRCAI; BRCC1; BROVCA1; FANCS; IRIS; PNCA4; PPP1R53; PSCP; RNF53
UniProt ID: (Human) P38398
Entrez Gene ID: (Human) 672
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support