Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD178 (aa 122-191) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-103987
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
2.2 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84227. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD178 (Fas ligand, FasL) is a type-II-membrane protein, whose N-terminus is in the cytoplasm and its C-terminal region extends into the extracellular space. Its receptor, FasR, is a cell-surface-type-I-membrane protein and a member of the tumor necrosis factor (TNF) and nerve growth factor (NGF) receptor family. As a member of the TNF-cytokine family CD178 induces apoptosis when interacting with FasR. CD178 may exist as either membrane bound (45 kD) or soluble forms (26 kD). The soluble protein can be released from cells upon cleavage by metalloproteinases. Binding of CD178 to Fas leads to oligomerization of the receptor and triggers apoptotic cell death through the interaction of other proteins. CD178 is predominantly expressed in activated T-lymphocytes and natural killer (NK) cells also it is expressed in the tissues of immune-privilege sites such as testis and eye. CD178 expression is also reported in various tissues as thymus, liver, ovary, lung, heart and kidney. It is assumed that induction of apoptosis through CD178 is predominantly involved in anti-viral immune responses. CD178 is a cell surface molecule belonging to the tumor necrosis factor family, binds to its receptor Fas, thus inducing apoptosis. Various cells express FAS, where CD178 is expressed predominantly on activated T cells. FAS and CD178 are involved in the down-regulation of immune reactions as well as T cell-mediated cytotoxicity. CD178 concentration has also been shown to be associated with atherosclerosis and inflammatory disease, in patients with hypertension. The Fas/ CD178 system has been shown to play a role in a number of human diseases, for example AIDS, hepatitis or cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Apoptosis (APO 1) antigen ligand 1; apoptosis (APO-1) antigen ligand 1; Apoptosis antigen ligand; APTL; CD178; CD178 antigen; CD95 ligand; CD95 ligand protein;Generalized lymphoproliferative disease (Gld); CD95-L; Fas antigen ligand; Fas ligand; Fas ligand (TNF superfamily, member 6); Fas-LG; mutant tumor necrosis factor family member 6; soluble form; TNFL; Tumor necrosis factor (ligand) superfamily member 6; Tumor necrosis factor ligand; tumor necrosis factor ligand 1A; Tumor necrosis factor ligand superfamily member 6; Tumor necrosis factor ligand superfamily member 6 (TNFL6 / TNFSF6)
Gene Aliases: ALPS1B; APT1LG1; APTL; CD178; CD95-L; CD95L; FASL; FASLG; TNFSF6; TNLG1A
UniProt ID: (Human) P48023
Entrez Gene ID: (Human) 356
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support