Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human CD47 (aa 18-135) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-101872
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
7.3 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD47, known as integrin-associated protein (IAP), is a glycosylated transmembrane glycoprotein with five domains, expressed widely across hematopoietic cells like T and B cells, monocytes, platelets, and erythrocytes, as well as non-hematopoietic cells. It interacts with integrins such as CD51/CD61 and CD41/CD61, and serves as a receptor for thrombospondin, mediating bi-directional signaling that affects neural synaptic activity and macrophage phagocytosis. CD47 acts as a ligand for CD172a (SIRP alpha), an inhibitory receptor on macrophages, preventing phagocytosis of CD47-positive cells. This interaction influences cell migration, B cell adhesion, T cell activation, and neuronal development, particularly in synapse-rich brain and retina regions. It also modulates chondrocyte responses to mechanical signals. T cell expression of CD47 can lead to activation or apoptosis in the presence of thrombospondin. Monoclonal antibody stimulation of CD47 has been shown to induce CD4+CD25- suppressive activity and increase Foxp3 expression. CD47's role in membrane transport, signal transduction, and its broad tissue distribution highlight its significance in various physiological processes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: antigen identified by monoclonal antibody 1D8; Antigenic surface determinant protein OA3; CD47; CD47 antigen; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 glycoprotein; IAP; integrin associated protein; Integrin-associated protein; integrin-associated signal transducer; Leukocyte surface antigen CD47; Protein MER6; Rh-related antigen; sCD47; soluble CD 47; soluble CD47
Gene Aliases: CD47; IAP; MER6; OA3
UniProt ID: (Human) Q08722
Entrez Gene ID: (Human) 961
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support