Search
Invitrogen
Human CTCFL Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-96690
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51584. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CTCFL is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes. CTCFL is normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: BORIS like protein; BORIS-like protein; Brother of the regulator of imprinted sites; Cancer/testis antigen 27; CCCTC-binding factor; CT27; CTCF paralog; CTCF T; CTCF-like protein; HMG 1L1; MGC163358; MGC169105; MGC169106; Transcriptional repressor CTCFL; unnamed protein product; Zinc finger protein CTCF-T; zinc finger protein; IsoBORIS Protein 1; zinc finger protein; IsoBORIS Protein 10; zinc finger protein; IsoBORIS Protein 11; zinc finger protein; IsoBORIS Protein 12; zinc finger protein; IsoBORIS Protein 13; zinc finger protein; IsoBORIS Protein 14; zinc finger protein; IsoBORIS Protein 15; zinc finger protein; IsoBORIS Protein 16; zinc finger protein; IsoBORIS Protein 17; zinc finger protein; IsoBORIS Protein 19; zinc finger protein; IsoBORIS Protein 2; zinc finger protein; IsoBORIS Protein 3; zinc finger protein; IsoBORIS Protein 4; zinc finger protein; IsoBORIS Protein 5; zinc finger protein; IsoBORIS Protein 6; zinc finger protein; IsoBORIS Protein 7; zinc finger protein; IsoBORIS Protein 8; zinc finger protein; IsoBORIS Protein 9
Gene Aliases: BORIS; CT27; CTCF-T; CTCFL; dJ579F20.2; HMGB1L1
UniProt ID: (Human) Q8NI51
Entrez Gene ID: (Human) 140690
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support