Search
Invitrogen
Human CXCR3 (aa 51-102) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-102985
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
QVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAF
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111225. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
CD183, also known as CXCR3, is a seven-transmembrane G protein-coupled chemokine receptor that binds CXCL9 (Mig), CXCL10 (IP-10), and CXCL11 (I-TAC), which are part of the CXC chemokine subfamily. CD183 plays a crucial role in leukocyte traffic, influencing integrin activation, cytoskeletal changes, and chemotactic migration. It is expressed on NK cells, subsets of T lymphocytes, regulatory T cells (Tregs), and is preferentially found on Th1-polarized cells. CD183 is prominently expressed in effector/memory T cells and T cells in inflamed tissues, contributing to CD4 T cell responses to grafts, as evidenced by compromised allograft rejection in CXCR3 knockout mice. Chemokine binding induces rapid, short-lived cellular responses due to receptor internalization, with responsiveness restored after receptor recycling. Inhibition by Bordetella pertussis toxin suggests coupling with Gi subclass G proteins. The production of IP-10, Mig, and I-TAC in inflammatory lesions indicates CD183 role in recruiting inflammatory cells, making it a target for developing antagonists to treat inflammatory diseases. Multiple transcript variants encoding different isoforms of CD183 have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: an; C Cmotif chemokine; C X C motif chemokine; C-X-C chemokine receptor type 3; CC motif chemokine; CCmotif chemokine; CD183; chemokine (C-X-C motif) receptor 3; chemokine (C-X-C motif) receptor 3 isoform CXCR3_1; chemokine (C-X-C motif) receptor 3 isoform CXCR3_2; chemokine receptor 3; CKR-L2; CXC; CXC motif chemokine; CXC-R3; CXCR3-B; G protein-coupled receptor; G protein-coupled receptor; G protein-coupled receptor 9; Interferon-inducible protein 10 receptor; IP-10 receptor; IP10; IP10 receptor; Mig receptor; unnamed protein product
Gene Aliases: CD182; CD183; CKR-L2; CMKAR3; CXCR3; GPR9; IP10-R; Mig-R; MigR
UniProt ID: (Human) P49682
Entrez Gene ID: (Human) 2833
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support