Search
Invitrogen
Human IL31RA (aa 592-672) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-108537
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111631. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
IL-31 is a T cell cytokine that is preferentially produced by T helper type 2 cells. IL-31 signals through a heterodimeric receptor composed of the IL-31 receptor (IL-31R) and the oncostatin M receptor (OSM). This receptor complex recruits JAK1, JAK2, Stat1, Stat3 and Stat5 signaling pathways, as well as the PI3 kinase/AKT cascade. SHP-2 and Shc adapter molecules are also recruited and contribute to an increased activation of the MAP kinase pathway in response to IL-31. Overexpression of IL-31 in mice results in pruritus and skin dermatitis resembling human atopic dermatitis (AD). Comparisons between skin from patients with AD and healthy skin showed IL-31R expression at higher levels on epidermal keratinocytes in AD samples. Infiltrating cells, more numerous in skin from patients with AD compared with that of healthy individuals, expressed IL-31 mRNA. IL-31 may participate in the cause of itch sensation and promote scratching behavior in NC/Nga mice with atopic dermatitis, and may represent a novel target for antipruritic drug development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: class I cytokine receptor; CRL 3; CRL3Glmr; Cytokine receptor-like 3; GLM R; GLM-R; GLM-RMGC125346; GP130 like receptor; Gp130-like monocyte receptor; Gp130-like receptor; HGLM R; hGLM-R; HGLMR; IL 31RA; IL-31 receptor subunit alpha; IL-31R subunit alpha; IL-31RAGPLCRL; IL31R subunit alpha; Interleukin-31 receptor subunit alpha; MGC125346; novel soluble type I cytokine receptor; PLCA 2; soluble type I cytokine receptor CRL3; type I cytokine receptor; unnamed protein product; ZcytoR17
Gene Aliases: CRL; CRL3; GLM-R; GLMR; GPL; hGLM-R; IL-31RA; IL31RA; PLCA2; PRO21384; UNQ6368/PRO21073/PRO21384; zcytoR17
UniProt ID: (Human) Q8NI17
Entrez Gene ID: (Human) 133396
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support