Search
Invitrogen
Human KLRB1 (aa 73-140) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-95606
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
KLRB1 (Killer cell lectin like receptor subfamily B, member 1, CD-161) protein is classified as a type II membrane protein because it has an external C terminus. KLRB1 cell surface antigen is expressed by almost all NK cells and in a small subset of CD3+ve T cells. KLRB1 is a homodimeric cell surface protein, comprising two chains with molecular weights ranging from 40-44kDa. KLRB1 plays an inhibitory role on natural killer (NK) cells. Activation of KLRB1 leads to acid sphingomyelnase/SMPD1 stimulation and an increase in intracellular ceramide. Moreover, there is also an activation of AKT1/PKB and RPS6KA1/RSK1 kinase stimulation, and T cell proliferation by anti-CD3. KLRB1 acts as a lectin that binds to the terminal carbohydrate Gal-alpha(1,3)Gal epitope and to the N-acetyllactosamine epitope. KLRB1 also binds to CLEC2D/LLT1 as a ligand, and inhibits NK cell-mediated cytotoxicity as well as interferon-gamma secretion in target cells. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: C-type lectin domain family 5 member B; CD161; HNKR-P1a; Killer cell lectin-like receptor subfamily B member 1; killer cell lectin-like receptor subfamily B, member 1; MGC138614; natural killer cell receptor; Natural killer cell surface protein P1A; NKR-P1A; unnamed protein product
Gene Aliases: CD161; CLEC5B; hNKR-P1A; KLRB1; NKR; NKR-P1; NKR-P1A; NKRP1A
UniProt ID: (Human) Q12918
Entrez Gene ID: (Human) 3820
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support