Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human KMT2E (aa 964-1057) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-101713
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
TYSQEGYDRSSTMLTLGPFRNSNLTELGLQEIKTIGYTSPRSRTEVNRQCPGEKEPVSDLQLGLDAVEPTALHKTLETPAHDRAEPNSQLDSTH
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The mixed lineage leukemia (MLL) gene family comprise a group of Histone H3 lysine 4 (H3K4) methyltransferases within the larger SET1 family. The founding member MLL commonly undergoes translocations in infantile leukemia and displays increased expression in some adult myeloid leukemias. MLL2, also designated ALR, exists within a complex of proteins. MLL2 is important for mouse embryonic development and may be involved in adhesion-related cytoskeletal events affecting cell growth and survival. The MLL2 gene maps to the human locus 19q13.1, which is a frequent target of rearrangement or amplification in solid tumors. MLL3 or its paralogue MLL4 associate with activating signal cointegrator-2 (ASC-2), which regulates ligand-dependent H3K4 trimethylation and expression of LXR-target genes. MLL3 maps to a location on human chromosome 7 that is often deleted in myeloid disorders. MLL3 also exhibits higher expression in peripheral blood, placenta, pancreas, testis, and fetal thymus. MLL5 localizes to the nucleus and forms intranuclear protein complexes, which may regulate chromatin remodeling and cellular growth suppression. The gene encoding human MLL5 lies within chromosome band 7q22.3, a region deleted in cytogenetic aberrations of acute myeloid malignancies.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: histone-lysine N-methyltransferase MLL5; Inactive histone-lysine N-methyltransferase 2E; Inactive lysine N-methyltransferase 2E; lysine (K)-specific methyltransferase 2E; MGC70452; myeloid/lymphoid or mixed-lineage leukemia 5 (trithorax homolog, Drosophila); Myeloid/lymphoid or mixed-lineage leukemia protein 5
Gene Aliases: HDCMC04P; KMT2E; MLL5; NKp44L
UniProt ID: (Human) Q8IZD2
Entrez Gene ID: (Human) 55904
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support