Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human MAGEC2 (aa 3-53) Control Fragment Recombinant Protein
Product Details
RP-101980
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPS
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (42%), Rat (42%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64010. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
MAGE-C2/C3 (Melanoma-associated antigen C2, Hepatocellular carcinoma-associated antigen 587) is a 373 amino acid protein encoded by the human gene MAGEC2. Genes of the MAGE family direct the expression of tumor antigens that are recognized on human melanomas by autologous cytolytic T lymphocytes. Among tumor tissues, MAGE-C2/C3 is frequently expressed in seminomas, melanomas, and bladder transitional cell carcinomas. It is also expressed in a significant fraction of head and neck carcinomas, breast carcinomas, nonsmall-cell lung carcinomas, and sarcomas. In hepatocellular carcinoma, there is a inverse correlation between tumor differentiation and protein expression, i. e. the lower the differentiation, the higher percentage of expression. MAGE-C2/C3 is not expressed in normal tissues, except in germ cells in the seminiferous tubules and in Purkinje cells of the cerebellum. It is strongly expressed in spermatogonia and primary spermatocytes, however, at later stages of maturation, expression gradually decreases to become undetectable in mature spermatids.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Cancer/testis antigen 10; CT10; hepatocellular cancer antigen 587; Hepatocellular carcinoma-associated antigen 587; MAGE-C2; MAGE-C2 antigen; MAGE-E1 antigen; melanoma antigen family C, 2; melanoma antigen family C2; melanoma antigen, family E, 1, cancer/testis specific; Melanoma-associated antigen C2
Gene Aliases: CT10; HCA587; MAGEC2; MAGEE1
UniProt ID: (Human) Q9UBF1
Entrez Gene ID: (Human) 51438
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support