Search
Invitrogen
Human NDUFAF2 (aa 1-83) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-104844
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Mimitin, a small mitochondrial protein, whose transcription is directly stimulated by c-Myc, is highly expressed in 80% of esophageal squamous cell carcinomas (ESCC). Suppression of Mimitin expression by RNA interference had no effect in cancerous cell lines such as human cervical carcinoma or hepatocarcinoma cell lines, but caused a decrease in cell proliferation in human glioblastoma, embryonic lung fibroblastic cells, and ESCC, suggesting Mimitin may play a special role in these types of cells. Mimitin expression is also regulated by MAPK kinases and IL-1, but not through the NF-kappa-B-related pathway. It will interact with the microtubular protein MAP1S and can affect the activities of caspase-3 and -7 in cells stimulated to develop apoptosis. Other experiments suggest that Mimitin also acts as a molecular chaperone for the assembly of the mitochondrial complex I.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: B17.2-like; B17.2L; B172-like; B172L; Mimitin; mimitin, mitochondrial; MMTN; Myc-induced mitochondrial protein; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2 isoform NDUFAF2_1; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2 isoform NDUFAF2_3; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex assembly factor 2 isoform NDUFAF2_4; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2; NADH dehydrogenase (ubiquinone) complex I, assembly factor 2; NADH dehydrogenase 1 alpha subcomplex assembly factor 2; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2; NDUFA12-like protein; unnamed protein product
Gene Aliases: B17.2L; MC1DN10; mimitin; MMTN; NDUFA12L; NDUFAF2
UniProt ID: (Human) Q8N183
Entrez Gene ID: (Human) 91942
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support