Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human NFYA (aa 208-338) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89282
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
ANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84030. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The NFYA gene encodes for one of the subunits of the Nuclear Factor Y (NF-Y) transcription factor, which plays a critical role in the regulation of various genes, particularly those containing the CCAAT box within their promoter regions. Structurally, NF-Y consists of a heterotrimeric complex made up of NF-YA, NF-YB, and NF-YC subunits. NF-YA serves as the sequence-specific DNA-binding component, whereas the NF-YB/NF-YC heterodimer forms a Histone Fold Domain crucial for DNA binding and stabilization. Functionally, NF-YA is pivotal in cell cycle regulation and neuronal development, influencing neural progenitor maintenance during brain morphogenesis. It has been implicated in various physiological processes, including response to plant stress and cancer progression. Specifically, NFYA gene activity is prevalent in proliferating cells and is often dysregulated in cancerous tissues, which highlights its potential as a therapeutic target. NFYA's expression in plant systems, such as in the Arabidopsis species, is modulated by environmental stresses like drought, indicating its broader impact on biological stress responses.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CAAT box DNA-binding protein subunit A; CAAT-box DNA binding protein subunit A; CCAAT-binding transcription factor subunit B; FLJ11236; HAP2 CCAAT-binding protein; nf-y; NF-YA; Nuclear transcription factor Y subunit A; Nuclear transcription factor Y subunit alpha; nuclear transcription factor Y, alpha; Transcription factor NF-Y, A subunit
Gene Aliases: CBF-A; CBF-B; HAP2; NF-YA; NFYA
UniProt ID: (Human) P23511
Entrez Gene ID: (Human) 4800
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support