Search
Invitrogen
Human P-Selectin Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-99385
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLW
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82230. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
P-selectin (Selectin P, GMP-140, LECAM3, CD62 antigen-like family member) is a 140 kDa type 1 transmembrane glycoprotein, and is one of the most commonly studied proteins that regulate cell rolling. P-selectin is stored in the Weibel-Palade bodies of endothelial cells, as well as in a-granules of platelets. From there, it can be rapidly brought to the cell surface after exposure to thrombin, histamine, complement 5a, Ca21 ionophores, or adenosine diphosphate. P-selectin protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. P-selectin plays an important role in adhesive processes between leucocytes and endothelial cells, and is a calcium dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens found on neutrophils and monocytes. P-selectin is constitutively expressed in inflammation and contributes to atherogenesis, thrombosis and tissue destruction. Clinically, P-selectin is used to distinguish heparin induced thrombocytopenia with and without thrombosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD62 antigen-like family member P; FLJ45155; GMP-140; granule membrane protein 140; granule membrane protein 140kDa; granule membrane protein-140 (GMP-140) precursor; granulocyte membrane protein; leukocyte-endothelial cell adhesion molecule 3; platelet activation dependent granule-external membrane protein; platelet activation-dependent granule to external membrane protein; platelet alpha-granule membrane protein; RP1-86F14.2; selectin P (granule membrane protein 140kDa antigen CD62) isoform SELP_1; selectin P (granule membrane protein 140kDa antigen CD62) isoform SELP_3; selectin P (granule membrane protein 140kDa, antigen CD62); unnamed protein product
Gene Aliases: CD62; CD62P; GMP140; GRMP; LECAM3; PADGEM; PSEL
UniProt ID: (Human) P16109
Entrez Gene ID: (Human) 6403
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support