Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-100893
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
FERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRD
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The pax genes are a family of transcription factors that are active in specific tissues during early embryonic development. Pax family members possess a DNA-binding domain encoded by the paired box. Because paired domain containing genes encode transcription factors, they are capable of executing a genetic program. Several pax genes have also been associated with developmental mutations including: pax-3, which is associated with Waardenburg syndrome, pax-6, which is associated with Aniridia, and pax-2, which is associated with Wilms tumor. During embryogenesis, Pax-2 is expressed in the developing kidney. In particular, the pax-2 gene is expressed in condensing metanephric mesenchyme and in early epithelial structures derived from mesenchyme; however, pax-2 mRNA and protein levels are rapidly down regulated as the tubular epithelium matures. Although Pax-2 is down regulated during renal epithelium maturation, Pax-2 expression persists in the undifferentiated epithelium of Wilms' tumors. Persistent expression of Pax-2 in Wilms' tumors occurs frequently and correlates with the proliferation of poorly differentiated epithelial cells in these tumors. Interestingly, expression of the Wilms' tumor suppresser protein, WT1, coincides with down-regulation of the pax-2 gene; thus, suggesting that WT1 can directly repress pax-2 transcription.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: paired box homeotic gene 2; Paired box protein Pax-2
Gene Aliases: FSGS7; PAPRS; PAX2
UniProt ID: (Human) Q02962
Entrez Gene ID: (Human) 5076
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support