Search
Invitrogen
Human POLR2H (aa 2-75) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-96417
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58085. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Eukaryotes produce 3 distinct classes of RNA polymerase, Pol I, II and III. Each polymerase is responsible for the synthesis of a different class of RNA. RNA polymerase I (Pol I) transcribes the rRNA (ribosomal RNA) genes for the precursor of the 28S, 18S, and 5. 8S molecules of the ribosome. RNA polymerase II transcribes protein-encoding genes into mRNA (messenger RNA) and snRNA (small nuclear RNA) genes into snRNAs that influence the processing of other classes of RNA. RNA polymerase III (Pol III) transcribes the 5S rRNA genes and all of the tRNA (transfer RNA) genes. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. The RPB6 and RPB8 subunits are shared by all 3 RNA polymerases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ABC3; DNA-directed RNA polymerase II subunit H; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; DNA-directed RNA polymerases I, II, and III subunit RPABC3; hRPB8; hsRPB8; polymerase (RNA) II (DNA directed) polypeptide H; polymerase (RNA) II subunit H; RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; RPB17; RPB8 homolog
Gene Aliases: POLR2H; RPABC3; RPB17; RPB8
UniProt ID: (Human) P52434
Entrez Gene ID: (Human) 5437
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support