Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PPIP5K2 (aa 897-974) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102789
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AKGCEEDKNLPSGYGYRPASRENEGRRPFKIDNDDEPHTSKRDEVDRAVILFKPMVSEPIHIHRKSPLPRSRKTATND
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58154. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
PPIP5K2, also known as inositol hexakisphosphate and diphosphoinositol pentakisphosphate kinase 2, is a gene located on chromosome 5 in humans. This gene encodes a kinase involved in the phosphorylation of inositol pyrophosphates, which are essential for cellular signaling and regulation processes. Specifically, PPIP5K2 phosphorylates InsP6 and 1-InsP7 at the 5 position, playing a significant role in both cellular proliferation and metastasis. Recent studies have shown that PPIP5K2 can facilitate the growth and spread of non-small lung cancer (NSCLC) and colorectal carcinoma. It promotes cellular proliferation and migration independent of its kinase activity, in part by modifying its interaction with proteins like 14-3-3, affecting its subcellular distribution. Structural analysis of PPIP5K2 reveals that it possesses unique kinetic properties distinct from other inositol kinase isoforms. Genetic variants, such as the Arg837His missense variant, can alter its phosphatase activity, potentially impacting its functionality in signaling pathways. PPIP5K2 is intricately involved in epithelial-mesenchymal transition (EMT) mechanisms, further influencing cancer cell metastasis. Understanding the biochemical pathways and genetic variations associated with PPIP5K2 is crucial in comprehending its role in disease pathogenesis and therapeutic targeting.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Diphosphoinositol pentakisphosphate kinase 2; Histidine acid phosphatase domain-containing protein 1; hsVIP2; inositol heptaphosphate kinase 2; Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2; InsP6 and PP-IP5 kinase 2; VIP1 homolog 2
Gene Aliases: CFAP160; HISPPD1; IP7K2; KIAA0433; PPIP5K2; VIP2
UniProt ID: (Human) O43314
Entrez Gene ID: (Human) 23262
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support