Search
Invitrogen
Human PRMT1 (aa 15-53) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-105554
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
VATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYY
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
PRMT1 is a member of the protein arginine N-methyltransferase (PRMT) family. Arginine methylation is an irreversible post translational modification which has been implicated in RNA processing and trafficking, receptor-mediated signaling, and transcription. At least three types of PRMT enzymes have been identified in mammalian cells. These enzymes have been shown to have essential regulatory functions by methylation of key proteins in several fundamental areas. These proteins include nuclear proteins, IL enhancer binding factor, nuclear factors, cell cycle proteins, signal transduction proteins, apoptosis proteins, and viral proteins. The mammalian PRMT family currently consists of 7 members that share two large domains of homology. Increased expression of PRMT1 may play a role in various types of cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: heterogeneous nuclear ribonucleoprotein methyltransferase 1-like 2; highly conserved protein 1; Histone-arginine N-methyltransferase PRMT1; HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 2; HRMT1L2; Interferon receptor 1-bound protein 4; Protein arginine N-methyltransferase 1; protein arginine N-methyltransferase 1 isoform 10; protein arginine N-methyltransferase 1 isoform 11; protein arginine N-methyltransferase 1 isoform 12; protein arginine N-methyltransferase 1 isoform 13; protein arginine N-methyltransferase 1 isoform 14; protein arginine N-methyltransferase 1 isoform 15; protein arginine N-methyltransferase 1 isoform 16; protein arginine N-methyltransferase 1 isoform 17; protein arginine N-methyltransferase 1 isoform 18; protein arginine N-methyltransferase 1 isoform 19; protein arginine N-methyltransferase 1 isoform 20; protein arginine N-methyltransferase 1 isoform 21; protein arginine N-methyltransferase 1 isoform 22; protein arginine N-methyltransferase 1 isoform 23; protein arginine N-methyltransferase 1 isoform 24; protein arginine N-methyltransferase 1 isoform 25; protein arginine N-methyltransferase 1 isoform 26; protein arginine N-methyltransferase 1 isoform 27; protein arginine N-methyltransferase 1 isoform 28; protein arginine N-methyltransferase 1 isoform 29; protein arginine N-methyltransferase 1 isoform 30; protein arginine N-methyltransferase 1 isoform 31; protein arginine N-methyltransferase 1 isoform 32; protein arginine N-methyltransferase 1 isoform 33; protein arginine N-methyltransferase 1 isoform 34; protein arginine N-methyltransferase 1 isoform 35; protein arginine N-methyltransferase 1 isoform 36; protein arginine N-methyltransferase 1 isoform 37; protein arginine N-methyltransferase 1 isoform 38; protein arginine N-methyltransferase 1 isoform 39; protein arginine N-methyltransferase 1 isoform 4; protein arginine N-methyltransferase 1 isoform 40; protein arginine N-methyltransferase 1 isoform 41; protein arginine N-methyltransferase 1 isoform 42; protein arginine N-methyltransferase 1 isoform 43; protein arginine N-methyltransferase 1 isoform 44; protein arginine N-methyltransferase 1 isoform 45; protein arginine N-methyltransferase 1 isoform 46; protein arginine N-methyltransferase 1 isoform 47; protein arginine N-methyltransferase 1 isoform 48; protein arginine N-methyltransferase 1 isoform 5; protein arginine N-methyltransferase 1 isoform 6; protein arginine N-methyltransferase 1 isoform 7; protein arginine N-methyltransferase 1 isoform 8; protein arginine N-methyltransferase 1 isoform 9; unnamed protein product
Gene Aliases: ANM1; HCP1; HMT2; HRMT1L2; IR1B4; PRMT1
UniProt ID: (Human) Q99873
Entrez Gene ID: (Human) 3276
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support