Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human PRRX2 (aa 156-253) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89393
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RAKFRRNERAMLASRSASLLKSYSQEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-110708, PA5-55423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The paired-class homeobox genes PRX1 and PRX2 are necessary for craniofacial and limb development and are expressed in similar patterns in the cranial mesenchyme, limb buds, axial mesoderm and branchial arches. These proteins exhibit different patterns of expression, however, in heart and brain tissue. Specifically, PRX1 is expressed in the endocardial cusions, semilunar and atrioventricular valves, whereas PRX2 is initially expressed in a diffuse myocardial pattern and is later expressed in the ventricular septum. Furthermore, PRX2 is never expressed in the brain, whereas PRX1 is expressed in the ventral hypothalamus and in the telencephalon. Murine mutants lacking PRX1 function demonstrate skeletal defects in the skull, limbs, and vertebral column. Mice lacking functional PRX2 alone do not demonstrate skeletal abnormalities, however, PRX1/PRX2 double mutants demonstrate novel abnormalities that are not visualized with the PRX1-deficient mice. Transcripts of neither PRX1 nor PRX2 are detected in normal adult rat pulmonary arteries, however vascular disease induces PRX gene expression wherein they co-localize to sites of Tenascin-C expression.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: MGC19843; Paired mesoderm homeobox protein 2; paired-like homeodomain protein PRX2; Paired-related homeobox protein 2; PRX-2; testicular tissue protein Li 148; testicular tissue protein Li 160
Gene Aliases: PMX2; PRRX2; PRX2
UniProt ID: (Human) Q99811
Entrez Gene ID: (Human) 51450
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support