Search
Invitrogen
Human PSMB10 (aa 200-273) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-95875
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The 20S proteasome is a protease complex that is responsible for cytosolic protein degradation and generation of peptide ligands for major histocompatibility complex (MHC) class I molecules, either in their final form or in the form of amino-terminally extended precursors. Upon IFN-gamma stimulation of cells, three constitutively expressed subunits of the 20S proteasome are replaced by inducible subunits LMP2 (low-molecular mass polypeptide 2), LMP7, and MECL-1 (multicatalytic endopeptidase complex-like-1, LMP10). LMP2, LMP7, and MECL-1 subunits form immunoproteasomes, which are associated with more efficient class I antigen processing and presentation. Independent assortment of LMP-2, LMP-7, and MECL-1 into different proteasome complexes can lead to 36 unique proteasome subsets, which may mediate differences in the cleavage specificities/cleavage motifs of proteins subject to constitutive- and immuno-proteasomes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Low molecular mass protein 10; Macropain subunit MECl-1; MGC1665; Multicatalytic endopeptidase complex subunit MECl-1; OTTHUMP00000174858; proteasome (prosome, macropain) subunit, beta type, 10; proteasome catalytic subunit 2i; Proteasome MECl 1; Proteasome MECl-1; proteasome subunit beta 10; proteasome subunit beta 7i; Proteasome subunit beta type-10; Proteasome subunit beta-2i; proteasome subunit beta2i; proteasome subunit MECL1; PSMB 10; PSMB10; unnamed protein product
Gene Aliases: beta2i; IMD121; LMP10; MECL1; PRAAS5; PSMB10
UniProt ID: (Human) P40306
Entrez Gene ID: (Human) 5699
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support