Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human RAD18 (aa 97-205) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89466
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCP
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52602. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Human Rad18 (hRad18) is homologue of the S. pombe Rad18 (3,4). In yeast, Rad6 and Rad18 play a crucial role in post-replication repair functions in gap-filling of a daughter strand on replication of damaged DNA (2). Furthermore, Rad6-Rad18 interaction is thought to be critical at an early step during lesion bypass in yeast. In vivo, Rad18 protein forms a tight complex with Rad6 through a conserved ring-finger motif (3,4). It has been suggested that Rad18-Rad6 complex binds to the damaged sites by the single-stranded DNA binding property of Rad 18. This is followed by degradation of the stalled components of DNA replication by ubiquitin-conjugating enzyme activity of Rad6 (1). The human Rad18 maps on chromosome 3p24-25, the region which is often deleted in lung, breast, ovary, and testis cancers. The human RAD18 gene codes for a protein of 495 amino acids with a predicted molecular weight of 56 kDa. The human Rad18 is ubiquitously expressed in various human tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: E3 ubiquitin-protein ligase RAD18; hHR18; hRAD18; postreplication repair protein hRAD18p; Postreplication repair protein RAD18; RAD18 E3 ubiquitin protein ligase; RAD18 homolog; RAD18, S. cerevisiae, homolog; RING finger protein 73; RING-type E3 ubiquitin transferase RAD18
Gene Aliases: RAD18; RNF73
UniProt ID: (Human) Q9NS91
Entrez Gene ID: (Human) 56852
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support