Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human RAP (aa 55-182) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-102336
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAKTSGKFSGEELDKLWREFLHHKEK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
3.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82324. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The term RAP typically refers to receptor-associated protein, encoded by the LRPAP1 gene, which plays a significant role in the trafficking and function of certain receptors within cells. RAP is primarily involved in the regulation of low-density lipoprotein receptor-related proteins (LRPs) by acting as a chaperone during protein transport within the endoplasmic reticulum (ER). It prevents premature ligand binding and assists in the proper folding and assembly of receptor complexes, ensuring efficient receptor function and trafficking to the cell surface. RAP also influences cellular processes related to cholesterol metabolism and cell signaling through its interactions with these receptors. Its function is crucial for transporting and recycling receptors involved in various pathways, including lipid metabolism, endocytosis, and cellular homeostasis. Dysregulation of RAP or related receptor functions can impact metabolic health and are implicated in conditions such as atherosclerosis, neurodegenerative disorders, and cancer.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 39 kDa receptor-associated protein; Alpha-2-macroglobulin receptor-associated protein; Alpha-2-MRAP; low density lipoprotein receptor-related protein associated protein 1; Low density lipoprotein receptor-related protein-associated protein 1; low density lipoprotein-related protein-associated protein 1 (alpha-2-macroglobulin receptor-associated protein 1); RAP
Gene Aliases: A2MRAP; A2RAP; alpha-2-MRAP; HBP44; LRPAP1; MRAP; MYP23; RAP
UniProt ID: (Human) P30533
Entrez Gene ID: (Human) 4043
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support