Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TFAM (aa 19-96) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-98372
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
AELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Mitochondrial transcription factor A (TFAM) is a crucial protein encoded by nuclear genes, but it is transported from the cytoplasm to mitochondria where it plays a key role in the maintenance and expression of mitochondrial DNA (mtDNA). It regulates the replication and transcription of mtDNA, ensuring the proper functioning of mitochondrial processes. Structurally, TFAM contains a molecular region known as the LC3 interacting region (LIR) motif, which allows it to bind to autophagy proteins such as LC3. This interaction is essential for the autolysosomal pathway, helping to eliminate leaked mtDNA and limit inflammation. TFAM levels vary across tissues, with notable effects on mitochondrial function; high levels can repress mtDNA expression in certain tissues, such as skeletal muscle, and contribute to deficiencies in oxidative phosphorylation (OXPHOS). Conversely, in other tissues like the heart, increased mtDNA copy number maintains a balanced TFAM-to-mtDNA ratio, preserving OXPHOS capacity. TFAM is integral to the packaging, stability, and replication of the mitochondrial genome, and disruptions in TFAM can have severe effects, including implications in neurodegeneration and other diseases related to mtDNA stress.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Mitochondrial transcription factor 1; mitochondrial transcription factor A; MtTF1; mtTFA; TCF-6; Transcription factor 6; transcription factor 6-like 1; Transcription factor 6-like 2; transcription factor 6-like 2 (mitochondrial transcription factor); transcription factor 6-like 3; Transcription factor A, mitochondrial
Gene Aliases: MTTF1; MTTFA; TCF6; TCF6L1; TCF6L2; TCF6L3; TFAM
UniProt ID: (Human) Q00059
Entrez Gene ID: (Human) 7019
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support