Search
Invitrogen
Human TIS11D (aa 1-78) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-98492
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
MSTTLLSAFYDVDFLCKTEKSLANLNLNNMLDKKAVGTPVAAAPSSGFAPGFLRRHSASNLHALAHPAPSPGSCSPKF
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61513. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
TIS11D, also known as ZFP36LA (zinc finger protein 36, C3H type-like 2), BRF2 (butyrate response factor 2), ERF2 or RNF162C, is a 494 amino acid protein that localizes to the nucleus and contains two CSH1-type zinc fingers. Belonging to the TIS11 family of early response proteins, TIS11D is thought to function as a nuclear transcription factor that binds to 5'UUAUUUAUUU-3' core RNA sequences and may regulate growth factor-induced cellular responses. The gene encoding TIS11D maps to human chromosome 2, which houses over 1, 400 genes and comprises nearly 8% of the human genome. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the ABCA12 gene, while the lipid metabolic disorder sitosterolemia is associated with defects in the ABCG5 and ABCG8 genes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Butyrate response factor 2; butyrate response factor 2 (EGF-response factor 2); EGF-response factor 2; ERF-2; mRNA decay activator protein ZFP36L2; Protein TIS11D; TISD; TPA-induced sequence 11d; ZFP36-like 2; zinc finger protein 36, C3H type-like 1; zinc finger protein 36, C3H type-like 2; Zinc finger protein 36, C3H1 type-like 2; zinc finger protein, C3H type, 36-like 2
Gene Aliases: BRF2; ERF-2; ERF2; OOMD13; OZEMA13; RNF162C; TIS11D; ZFP36L2
UniProt ID: (Human) P47974
Entrez Gene ID: (Human) 678
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support