Search
Invitrogen
Human MAVS (aa 415-500) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-103160
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Two distinct signaling pathways activate the host innate immunity against viral infection. One pathway is reliant on members of the Toll-like receptor (TLR) family while the other uses the RNA helicase RIG-I as a receptor for intracellular viral double-stranded RNA as a trigger for the immune response. MAVS is a mitochondrial membrane protein that was identified as a critical component in the IFN beta signaling pathways that recruits IRF-3 to RIG-I, leading to its activation and that of NF-kappa-B. MAVS is also thought to interact with other components of the innate immune pathway such as the TLR adapter protein TRIF, TRAF2 and TRAF6. MAVS also interacts with the IKK-alpha, IKK-beta and IKK-iota kinases through its C-terminal region. Cleavage of this region by the Hepatitis C virus (HCV) protease allows HCV to escape the host immune system. Multiple isoforms of MAVS are known to exist.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CARD adapter inducing interferon beta; CARD adaptor inducing IFN-beta; Cardif; IFN-B promoter stimulator 1; Interferon beta promoter stimulator protein 1; IPS-1; MAVS; Mitochondrial antiviral-signaling protein; Putative NF-kappa-B-activating protein 031N; unnamed protein product; virus-induced signaling adaptor; Virus-induced-signaling adapter; VISA; VISA1a; VISA1b
Gene Aliases: CARDIF; IPS-1; IPS1; KIAA1271; MAVS; VISA
UniProt ID: (Human) Q7Z434
Entrez Gene ID: (Human) 57506
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support